Anti-Angiotensinogen antibody (ab97381)
Key features and details
- Rabbit polyclonal to Angiotensinogen
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Angiotensinogen antibody
See all Angiotensinogen primary antibodies -
Description
Rabbit polyclonal to Angiotensinogen -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human Angiotensinogen aa 1-446.
Sequence:MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNEST CEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDK LRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGA LDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQ AQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEK IDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAE LPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQL
Database link: P01019 -
Positive control
- WB: HepG2 lysate. Mouse and Rat plasma. IHC-P: Hepatocellular carcinoma Huh7 xenograft. ICC/IF: HepG2 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab97381 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
1/100 - 1/1000.
|
|
WB |
1/500 - 1/3000. Predicted molecular weight: 53 kDa.
|
|
IHC-P |
1/100 - 1/250.
|
Notes |
---|
ICC/IF
1/100 - 1/1000. |
WB
1/500 - 1/3000. Predicted molecular weight: 53 kDa. |
IHC-P
1/100 - 1/250. |
Target
-
Function
Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2.
Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
Angiotensin-3 stimulates aldosterone release.
Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets. -
Tissue specificity
Expressed by the liver and secreted in plasma. -
Involvement in disease
Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT) [MIM:145500]. Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause.
Defects in AGT are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). -
Sequence similarities
Belongs to the serpin family. -
Post-translational
modificationsBeta-decarboxylation of Asp-34 in angiotensin-2, by mononuclear leukocytes produces alanine. The resulting peptide form, angiotensin-A, has the same affinity for the AT1 receptor as angiotensin-2, but a higher affinity for the AT2 receptor. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 183 Human
- Entrez Gene: 11606 Mouse
- Entrez Gene: 24179 Rat
- Omim: 106150 Human
- SwissProt: P01019 Human
- SwissProt: P11859 Mouse
- SwissProt: P01015 Rat
- Unigene: 19383 Human
see all -
Alternative names
- Aangiotensinogen (serpin peptidase inhibitor clade A member 8) antibody
- AGT antibody
- AI265500 antibody
see all
Images
-
Immunohistochemical analysis of paraffin-embedded Hepatocellular carcinoma Huh7, using Angiotensinogen antibody (ab97381) at 1/100 dilution.
-
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Rat plasma at 50 µg
Predicted band size: 53 kDa -
HepG2 cells stained for Angiotensinogen using ab97381 at 1/200 dilution in ICC/IF.
-
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Mouse plasma at 50 µg
Predicted band size: 53 kDa -
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg
Predicted band size: 53 kDa
10% SDS PAGE
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab97381 has not yet been referenced specifically in any publications.