You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-BRCA1 antibody (ab14003)

CodeSizePriceAbpointsAvailability
    
 
  • -

  •   
  •   
  •   
  •  

  •  
  •  
  •  

  •  
Updating...

Reassurance, Refunds & Replacements

If your product does not perform as described on this datasheet, we will refund or replace your product...

Read our guarantee »

Overview

Product name

Anti-BRCA1 antibody
See all BRCA1 products (25) ...

Description

Chicken polyclonal to BRCA1

Tested applications

WBmore details

Cross reactivity

Reacts with

Human

Immunogen

Synthetic peptide: QQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIIS DSSALE DLRNPEQSTSEKAV, corresponding to amino acids 1395-1454 of Human BRCA1.

QQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIIS DSSALE DLRNPEQSTSEKAV

Properties

Form

Liquid

Storage instructions

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Storage buffer

Preservative: 0.02% Sodium Azide
Constituents: PBS

Concentration

Concentration information loading...

Purity

Immunogen affinity purified

Purification notes

Peptide immunogen affinity column

Clonality

Polyclonal

Isotype

IgY

  • Western blot - BRCA1 antibody (ab14003)Western blot - BRCA1 antibody (ab14003) image (enlarge)

Applications

Show applications key

Our Abpromise guarantee covers the use of ab14003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Target

Function

E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent loading of BRCA2-RAD51 repair machinery at DNA breaks.

Tissue specificity

Isoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and ovarian cancer cell lines.

Pathway

Protein modification; protein ubiquitination.

Involvement in disease

Defects in BRCA1 are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Note=Mutations in BRCA1 are thought to be responsible for 45% of inherited breast cancer. Moreover, BRCA1 carriers have a 4-fold increased risk of colon cancer, whereas male carriers face a 3-fold increased risk of prostate cancer. Cells lacking BRCA1 show defects in DNA repair by homologous recombination.
Defects in BRCA1 are a cause of susceptibility to breast-ovarian cancer familial type 1 (BROVCA1) [MIM:604370]. A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate. Note=Mutations in BRCA1 are thought to be responsible for more than 80% of inherited breast-ovarian cancer.
Defects in BRCA1 are a cause of genetic susceptibility to ovarian cancer [MIM:113705].

Sequence similarities

Contains 2 BRCT domains.
Contains 1 RING-type zinc finger.

Domain

The BRCT domains recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the phosphorylated pSXXF motif of FAM175A/Abraxas, recruits BRCA1 at DNA damage sites.
The RING-type zinc finger domain interacts with BAP1.

Post-translational
modifications

Phosphorylation at Ser-308 by STK6/AURKA is required for normal cell cycle progression from G2 to mitosis. Phosphorylated in response to IR, UV, and various stimuli that cause checkpoint activation, probably by ATM or ATR.
Autoubiquitinated, undergoes 'Lys-6'-linked polyubiquitination. 'Lys-6'-linked polyubiquitination does not promote degradation.

Cellular localization

Cytoplasm; Nucleus. Localizes at sites of DNA damage at double-strand breaks (DSBs) and recruitment to DNA damage sites is mediated by the BRCA1-A complex.

Target information above from: UniProt accessionP38398 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).

Information by UniProt

Alternative names

  • RING finger protein 53 antibody
  • BRAC 1 antibody
  • BRCA 1 antibody
  • BRCA1 antibody
  • BRCA1/BRCA2 containing complex subunit 1 antibody
  • BRCA1_HUMAN antibody
  • BRCAI antibody
  • BRCC 1 antibody
  • BRCC1 antibody
  • Breast and ovarian cancer susceptibility protein 1 antibody
  • Breast Cancer 1 antibody
  • Breast Cancer 1 Early Onset antibody
  • Breast cancer type 1 susceptibility protein antibody
  • Breast Ovarian Cancer Susceptibility antibody
  • BROVCA1 antibody
  • IRIS antibody
  • Papillary Serous Carcinoma Of The Peritoneum antibody
  • PNCA4 antibody
  • PPP1R53 antibody
  • Protein phosphatase 1 regulatory subunit 53 antibody
  • PSCP antibody
  • RING finger protein 53 antibody
  • RNF53 antibody
see all

Anti-BRCA1 antibody images:

  Western blot - BRCA1 antibody (ab14003)

Western blot - BRCA1 antibody (ab14003)



Predicted band size : 220 kDa


ab14003 at a 1/2000 dilution staining E.coli derived human BRCA1 fusion protein by western blot (colorimetric demonstration).

References for Anti-BRCA1 antibody (ab14003)

ab14003 has not yet been referenced specifically in any publications.

Publishing research using ab14003? Please let us know so that we can cite the reference in this datasheet

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"