You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameBRSK1 protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 591-778 of Human BRSK1, with N terminal His tag, 188aa, 23kDa, Swissprot: Q8TDC3
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:reconstitution with 149 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSS EGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQ AQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGR PDPELSSSPRRGPPKDKKLLATNGTPLP
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92049 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        BR serine/threonine kinase 1BR serine/threonine protein kinase 1BR serine/threonine-protein kinase 1
        Brain-specific serine/threonine-protein kinase 1BRSK 1Brsk1BRSK1_HUMANFLJ43009KIAA1811Protein kinase SAD1ASAD 1SAD1SAD1 kinaseSAD1ASADBSadB kinase short isoformSerine/threonine kinase SAD BSerine/threonine-protein kinase SAD-BSynapses of Amphids Defective homolog
      see all
  • FunctionRequired for the polarization of forebrain neurons which endows axons and dendrites with distinct properties, possibly by locally regulating phosphorylation of microtubule-associated proteins (By similarity). May be involved in the regulation of G2/M arrest in response to UV- or methyl methane sulfonate (MMS)-induced, but not IR-induced, DNA damage. Phosphorylates WEE1 and CDC25B in vitro and CDC25C in vitro and in vivo.
  • Tissue specificityWidely expressed, with highest levels in brain and testis. Protein levels remain constant throughout the cell cycle.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Cellular localizationCytoplasm. Nucleus. Nuclear in the absence of DNA damage. Translocated to the nucleus in response to UV- or MMS-induced DNA damage.

    • Target information above from: UniProt accession Q8TDC3 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    BRSK1 protein (Tagged-His Tag) images

    • SDS-PAGE - BRSK1 protein (Tagged-His Tag) (ab92049)
      SDS-PAGE - BRSK1 protein (Tagged-His Tag) (ab92049)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. A coloured control band can be seen at 15 kDa (green). The protein-specific band is blue.

    References for BRSK1 protein (Tagged-His Tag) (ab92049)

    ab92049 has not yet been referenced specifically in any publications.

    Publishing research using ab92049 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92049 Submit a Question for ab92049

    There are currently no Abreviews or Questions for ab92049.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"