Overview

  • Product name
    Anti-BVES antibody - C-terminal
    See all BVES primary antibodies
  • Description
    Rabbit polyclonal to BVES - C-terminal
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BVES aa 264-360 (C terminal).
    Sequence:

    LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGT SSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP


    Database link: Q8NE79

  • Positive control
    • IHC-P: Human heart muscle tissue. ICC/IF: RH-30 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading.
  • Tissue specificity
    Expressed in epithelial cells (at protein level). Expressed in fetal and adult heart and skeletal muscle.
  • Sequence similarities
    Belongs to the popeye family.
  • Cellular localization
    Lateral cell membrane. Cell junction > tight junction. Membrane. Colocalizes with VAMP3 at the cell-cell contact in cardiac and skeletal muscle (By similarity). Its movement from the cytoplasm to membrane is an early event occurring concurrently with cell-cell contact. Colocalizes in epithelial cells with OCLN and TJP1 in an apical-lateral position within the z axis. Detected at cell-cell contact but never observed at the free surface of epithelial cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • Blood vessel epicardial substance antibody
    • Bves antibody
    • hBVES antibody
    • MGC42413 antibody
    • POP 1 antibody
    • POP1 antibody
    • POPD1_HUMAN antibody
    • POPDC 1 antibody
    • POPDC1 antibody
    • Popeye domain containing 1 antibody
    • Popeye domain containing protein 1 antibody
    • Popeye domain-containing protein 1 antibody
    • Popeye protein 1 antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for BVES using ab224374 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for BVES (green) using ab224374 at 4 µg/ml in ICC/IF.

References

ab224374 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up