Overview

  • Product name
    Anti-BYSL antibody
  • Description
    Rabbit polyclonal to BYSL
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human BYSL aa 1-50 (N terminal). The exact sequence is proprietary. NP_004044.3
    Sequence:

    MPKFKAARGVGGQEKHAPLADQILAGNAVRAGVREKRRGRGTGEAEEEYV


    Database link: Q13895

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab194961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 50 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      Required for processing of 20S pre-rRNA precursor and biogenesis of 40S ribosomal subunits. May be required for trophinin-dependent regulation of cell adhesion during implantation of human embryos.
    • Tissue specificity
      Found in the placenta from the sixth week of pregnancy. Was localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the level decreased and then disappeared from placental villi.
    • Sequence similarities
      Belongs to the bystin family.
    • Cellular localization
      Cytoplasm. Nucleus > nucleolus. Associated with 40S ribosomal subunits.
    • Information by UniProt
    • Database links
    • Alternative names
      • by the ribosomal protein s6 gene drosophila homolog like antibody
      • BYSL antibody
      • BYST_HUMAN antibody
      • Bystin antibody
      • bystin like antibody
      see all

    Images

    • All lanes : Anti-BYSL antibody (ab194961) at 0.4 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique

      Predicted band size : 50 kDa


      Exposure time : 3 minutes

      Cell lysates prepared using NETN lysis buffer.

    References

    ab194961 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab194961.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up