Overview

  • Product name
  • Description
    Rabbit polyclonal to Beta TRCP
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Beta TRCP aa 50-340.
    Sequence:

    AFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTA MKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQ VEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSY LDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWG QYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCR SETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILT


    Database link: Q9Y297

  • Positive control
    • Kidney cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab188511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 69 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes and binds to phosphorylated target proteins. SCF(BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF(BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF(BTRC) mediates the ubiquitination of phosphorylated SNAI1. May be involved in ubiquitination and subsequent proteasomal degradation through a DBB1-CUL4 E3 ubiquitin-protein ligase. Required for activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB and TNF. Required for proteolytic processing of GLI3.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 WD repeats.
  • Domain
    The N-terminal D domain mediates homodimerization.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Beta transducin repeat containing E3 ubiquitin protein ligase antibody
    • beta TrCP1 antibody
    • beta-transducin repeat containing antibody
    • BETA-TRCP antibody
    • betaTrCP antibody
    • btrC antibody
    • bTrCP antibody
    • bTrCP1 antibody
    • E3RSIkappaB antibody
    • F box and WD repeat protein 1B antibody
    • F box and WD repeats protein beta TrCP antibody
    • F-box and WD repeats protein beta-TrCP antibody
    • F-box/WD repeat protein 1A antibody
    • F-box/WD repeat-containing protein 1A antibody
    • FBW1A antibody
    • FBW1A_HUMAN antibody
    • FBXW1 antibody
    • FBXW1A antibody
    • FWD1 antibody
    • HOS antibody
    • mKIAA4123 antibody
    • pIkappaBalpha-E3 receptor subunit antibody
    • Slimb antibody
    see all

Images

  • Anti-Beta TRCP antibody (ab188511) at 1/500 dilution + Kidney cell line lysate

    Predicted band size : 69 kDa

References

ab188511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up