Anti-C1orf106/INAVA antibody (ab121945)
Key features and details
- Rabbit polyclonal to C1orf106/INAVA
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C1orf106/INAVA antibody -
Description
Rabbit polyclonal to C1orf106/INAVA -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human C1orf106/INAVA aa 297-377.
Sequence:PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSES SSPATTPQDGPSASSLWLLEPASYHVVPIRG
Database link: Q3KP66 -
Positive control
- RT-4 lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121945 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use a concentration of 0.04 - 0.4 µg/ml.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 55765 Human
- SwissProt: Q3KP66 Human
- Unigene: 518997 Human
-
Alternative names
- C1orf106 antibody
- CA106_HUMAN antibody
- Chromosome 1 open reading frame 106 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab121945 has been referenced in 2 publications.
- Luong P et al. INAVA-ARNO complexes bridge mucosal barrier function with inflammatory signaling. Elife 7:N/A (2018). PubMed: 30355448
- Yan J et al. An inflammatory bowel disease-risk variant in INAVA decreases pattern recognition receptor-induced outcomes. J Clin Invest 127:2192-2205 (2017). PubMed: 28436939