You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameCBLB protein (Tagged-His Tag)
  • Protein descriptionRecombinant full length protein, corresponding to amino acids 1-197 of Human CBLB with N terminal His tag, 28kDa (21.4kDa predicted from sequence) (BAG53874.1).
  • Expression hostE. coli
  • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 137 µl distilled water.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesMLNGTHGPSSEKKSNIPDLSIYLKGEDAFDALPPSLPPPP PPARHSLIEHSKPPGS SSRPSSGQDLLLLPSDPFVDLA SGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSD GSQA PARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMG EGYAFEEVKRAL EIAQNNVEVARSILREFAFPPPVSPR LNL
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab91904 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        AI429560AI851073Cas Br M (murine) ecotropic retroviral transforming sequence b
        Casitas B lineage lymphoma bCasitas B lineage lymphoma proto oncogene bCbl bDKFZp686J10223DKFZp779A0729DKFZp779F1443E3 ubiquitin protein ligase CBL BEC 6.3.2.-FLJ36865FLJ41152Nbla00127RING finger protein 56RNF56SH3 binding protein CBL BSignal transduction protein CBL B
      see all
  • RelevanceCBLB (Cas Br M (murine) ecotropic retroviral transforming sequence b) has high homology to CBL, the proto-oncogene that induces pre-B cell lymphomas and myeloid leukemias in mice. Like CBL, CBLB contains putative nuclear localization signal, zinc finger, leucine zipper, and proline-rich domains. CBLB associates with FYN, FGR, and PLCG1. Acts an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. May also be involved in EGFR ubiquitination and internalization. In addition to its role in the prevention of chronic inflammation and autoimmunity, CBLB also has a function in acute lung inflammation. There are 4 isoforms produced by alternative splicing.
  • Cellular localizationCytoplasmic and Nuclear
  • CBLB protein (Tagged-His Tag) images

    • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for CBLB protein (Tagged-His Tag) (ab91904)

    ab91904 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab91904.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"