You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameCDT1 protein (Tagged-His Tag)See all CDT1 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 416-546 (131 amino acids) of Human CDT1 with N terminal His tag; Predicted MWt 16 kDa (UniProt Q9H211).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 92 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLP ELARVLRS VFVSERKPALSMEVACARMVGSCCTIMSPG EMEKHLLLLSELLPDWLS LHRIRTDTYVKLDKAADLAH ITARLAHQTRAEEGL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92045 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        CDT 1cdt1CDT1_HUMAN
        Chromatin licensing and DNA replication factor 1DNA replication factorDNA replication factor Cdt1Double parkedDouble parked Drosophila homolog ofDouble parked homologDUPRetroviral integration site 1Retroviral integration site 2Retroviral integration site1Retroviral integration site2RIS 2RIS2
      see all
  • FunctionCooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. Binds DNA in a sequence-, strand-, and conformation-independent manner. Potential oncogene.
  • Sequence similaritiesBelongs to the Cdt1 family.
  • Developmental stagePresent during G1 and early S phase of the cell cycle. Degraded during the late S, G2, and M phases.
  • DomainThe PIP-box K+4 motif mediates both the interaction with PCNA and the recuitment of the DCX(DTL) complex: while the PIP-box interacts with PCNA, the presence of the K+4 submotif, recruits the DCX(DTL) complex, leading to its ubiquitination.
  • Post-translational
    modifications    Ubiquitinated by the DCX(DTL) complex, also named CRL4(CDT2) complex, in response to DNA damage, leading to its degradation. Ubiquitination by the DCX(DTL) complex is necessary to ensure proper cell cycle regulation and is PCNA-dependent: interacts with PCNA via its PIP-box, while the presence of the containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to its degradation. The interaction with GMNN protects it against ubiquitination.
    Phosphorylated by cyclin A-dependent kinases which results in the binding of CDT1 to the F-box protein SKP2 and subsequent degradation. Binding to GMNN is not affected by phosphorylation.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession Q9H211 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    CDT1 protein (Tagged-His Tag) images

    • SDS-PAGE - CDT1 protein (Tagged-His Tag) (ab92045)
      SDS-PAGE - CDT1 protein (Tagged-His Tag) (ab92045)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for CDT1 protein (Tagged-His Tag) (ab92045)

    ab92045 has not yet been referenced specifically in any publications.

    Publishing research using ab92045 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92045 Submit a Question for ab92045

    There are currently no Abreviews or Questions for ab92045.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"