Anti-CHX10 antibody - ChIP Grade (ab16141)
Overview
- Product nameAnti-CHX10 antibody - ChIP GradeSee all CHX10 primary antibodies ...
- DescriptionSheep polyclonal to CHX10 - ChIP Grade
- Tested applicationsWB, ChIP, IHC-P more details
- Species reactivityReacts with: Mouse, Rat, Cow, Human
- Immunogen
Recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRE NSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAM DEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10.
- Positive controlRat or mouse retinal tissue lysate.
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
- Storage bufferPreservative: 0.08% Sodium Azide
Constituents: PBS -
Concentration information loading... - PurityIgG fraction
- Purification notesThis antibody is provided as a 0.2 µm sterile filtered solution.
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab16141 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | |
| ChIP | |
| IHC-P |
IHC-P: 1/200 (PMID 18981228).
WB: Use at a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Target
- FunctionPlays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells.
- Tissue specificityAbundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate.
- Involvement in diseaseDefects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2) [MIM:610093]; also known as isolated clinical anophthalmia. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present.
Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092].
Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3) [MIM:610092]; also known as isolated colobomatous microphthalmia 3. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure). - Sequence similaritiesBelongs to the paired homeobox family.
Contains 1 CVC domain.
Contains 1 homeobox DNA-binding domain. - Cellular localizationNucleus.
-
Database links
- Entrez Gene: 338917 Human
- Entrez Gene: 12677 Mouse
- Entrez Gene: 171360 Rat
- Omim: 142993 Human
- SwissProt: P58304 Human
- SwissProt: Q61412 Mouse
- Unigene: 449771 Human
- Unigene: 4405 Mouse
- Unigene: 92414 Rat
see all
Target information above from: UniProt accession
P58304
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010)
.
-
Alternative names
- C elegans ceh 10 homeo domain containing homolog antibodyCeh 10 homeo domain containing homolog (C. elegans) antibodyCeh 10 homeo domain containing homolog antibody
- Ceh 10 homeodomain containing homolog antibodyCeh 10 homeodomain containing homolog (C. elegans) antibodyCeh-10 homeodomain containing homolog antibodyCeh-10 homeodomain-containing homolog antibodyCeh10 homeo domain containing homolog antibodyCeh10 homeodomain containing homolog antibodyCHX 10 antibodyHomeobox protein CHX 10 antibodyHomeobox protein CHX10 antibodyHOX 10 antibodyHOX10 antibodyMCOP 2 antibodyMCOP2 antibodyMCOPCB 3 antibodyMCOPCB3 antibodyRET 1 antibodyRET1 antibodyVisual system homeobox 2 antibodyVsx 2 antibodyVsx2 (gene name) antibodyVsx2 antibodyVSX2_HUMAN antibody
see all
Anti-CHX10 antibody - ChIP Grade images
-
Western blot analysis using ab16141 at 1 µg/ml on rat liver (A), rat retina tissue lysate (B), mouse liver (C) and mouse retina tissue lysate (D).
References for Anti-CHX10 antibody - ChIP Grade (ab16141)
This product has been referenced in:
- Chang HH et al. Intravitreal homocysteine-thiolactone injection leads to the degeneration of multiple retinal cells, including photoreceptors. Mol Vis 17:1946-56 (2011). IHC-P ; Mouse . Read more (PubMed: 21850169) »
- Liu W et al. Neuroretina specification in mouse embryos requires Six3-mediated suppression of Wnt8b in the anterior neural plate. J Clin Invest 120:3568-77 (2010). IHC ; Mouse . Read more (PubMed: 20890044) »


