You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameCalpain 3 proteinSee all Calpain 3 proteins and peptides ...
  • Protein descriptionRecombinant fragment (amino acids 722-821) of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag (P20807).
  • Uniprot accessionP20807
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • E.C. Number3.4.22.54
  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • SequenceNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQ LYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDK DGDGIIKLNVLEWLQLTMYA
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114577 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration. (Recombinant protein)
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        Calcium-activated neutral proteinase 3calpain 3, (p94)Calpain L3
        Calpain large polypeptide L3Calpain p94calpain p94, large [catalytic] subunitcalpain, large polypeptide L3Calpain-3CAN3_HUMANCANP 3CANP3CANPL3CAPN3LGMD 2ALGMD2LGMD2ALp82Lp85MGC10767MGC11121MGC14344MGC4403Muscle-specific calcium-activated neutral protease 3muscle-specific calcium-activated neutral protease 3 large subunitnCL-1New calpain 1p94
      see all
  • FunctionCalcium-regulated non-lysosomal thiol-protease.
  • Tissue specificityIsoform I is skeletal muscle specific.
  • Involvement in diseaseDefects in CAPN3 are the cause of limb-girdle muscular dystrophy type 2A (LGMD2A) [MIM:253600]. LGMD2A is an autosomal recessive degenerative myopathy characterized by progressive symmetrical atrophy and weakness of the proximal limb muscles and elevated serum creatine kinase. The symptoms usually begin during the first two decades of life, and the disease gradually worsens, often resulting in loss of walking ability 10 or 20 years after onset.
  • Sequence similaritiesBelongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 4 EF-hand domains.
  • Cellular localizationCytoplasm.

    • Target information above from: UniProt accession P20807 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Calpain 3 protein images

    • SDS-PAGE - Calpain 3 protein (ab114577)
      SDS-PAGE - Calpain 3 protein (ab114577)
      ab114577 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

    References for Calpain 3 protein (ab114577)

    ab114577 has not yet been referenced specifically in any publications.

    Publishing research using ab114577 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114577 Submit a Question for ab114577

    There are currently no Abreviews or Questions for ab114577.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"