Anti-Carboxypeptidase Y antibody (ab181691)
Key features and details
- Rabbit polyclonal to Carboxypeptidase Y
- Suitable for: WB
- Reacts with: Saccharomyces cerevisiae
- Isotype: IgG
Overview
-
Product name
Anti-Carboxypeptidase Y antibody
See all Carboxypeptidase Y primary antibodies -
Description
Rabbit polyclonal to Carboxypeptidase Y -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Saccharomyces cerevisiae -
Immunogen
Full length native protein (purified) corresponding to Saccharomyces cerevisiae Carboxypeptidase Y aa 112-532.
Sequence:KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWL NGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVG FSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGH YIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPS VLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQR TGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNF DINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWT DVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVP FDVPENALSMVNEWIHGGFS L
Database link: P00729 -
Positive control
- S. cerevisiae Carboxypeptidase Y protein.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.50
Preservative: 0.01% Sodium azide
Constituents: 0.27% Tripotassium orthophosphate, 0.88% Sodium chloride
No stabilizer. -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181691 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Rabbit Serum as well as purified and partially purified S. cerevisiae Carboxypeptidase Y. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181691 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000 - 1/5000. Detects a band of approximately 57 kDa (predicted molecular weight: 60 kDa).
|
Notes |
---|
WB
1/1000 - 1/5000. Detects a band of approximately 57 kDa (predicted molecular weight: 60 kDa). |
Target
-
Function
Involved in degradation of small peptides. Digests preferentially peptides containing an aliphatic or hydrophobic residue in P1' position, as well as methionine, leucine or phenylalanine in P1 position of ester substrate. -
Sequence similarities
Belongs to the peptidase S10 family. -
Post-translational
modificationsEnters the endoplasmic reticulum as an inactive zymogen and is modified by four N-linked core oligosaccharides, giving rise to a precursor known as P1 (67 kDa). As P1 transits through the Golgi, extension of its core oligosaccharides leads to the Golgi-modified P2 precursor (69 kDa). P2 is sorted away from secretory proteins at or beyond a late Golgi compartment and is subsequently delivered to the vacuole via a prevacuolar endosome-like compartment. Upon arrival in the vacuole, the N-terminal prosegment of P2 is cleaved to yield the enzymatically active mature vacuolar form of CPY (61 kDa). -
Cellular localization
Vacuole. Lysosome-like vacuoles. - Information by UniProt
-
Database links
- Entrez Gene: 855343 Saccharomyces cerevisiae
- SwissProt: P00729 Saccharomyces cerevisiae
-
Alternative names
- carboxypeptidase C PRC1 antibody
- Carboxypeptidase Y antibody
- Carboxypeptidase YSCY antibody
see all
Images
-
Anti-Carboxypeptidase Y antibody (ab181691) at 1/1000 dilution + S. cerevisiae Carboxypeptidase Y at 0.05 µg
Secondary
Peroxidase rabbit at 1/40000 dilution
Developed using the ECL technique.
Predicted band size: 60 kDa
Observed band size: 57 kDa why is the actual band size different from the predicted?
Datasheets and documents
-
Datasheet download
References (0)
ab181691 has not yet been referenced specifically in any publications.