Overview

  • Product nameAnti-Caspase-1 antibodySee all Caspase-1 primary antibodies ...
  • Description
    Mouse monoclonal to Caspase-1
  • Tested applicationsIHC-P, WBmore details
  • Species reactivity
    Reacts with: Human, Recombinant Fragment
  • Immunogen

    Recombinant fragment corresponding to Human Caspase-1 aa 1-100.
    Sequence:

    MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQR IWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL

Properties

Applications

Our Abpromise guarantee covers the use of ab54932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
WB
  • Application notesWB: Use at a concentration of 1-5 µg/ml.
    IHC-P: Use at a concentration of 3 µg/ml.

    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionThiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.
    • Tissue specificityExpressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.
    • Sequence similaritiesBelongs to the peptidase C14A family.
      Contains 1 CARD domain.
    • Post-translational
      modifications
      The two subunits are derived from the precursor sequence by an autocatalytic mechanism.
    • Cellular localizationCytoplasm.
    • Information by UniProt
    • Database links
    • Alternative names
      • CASP 1 antibody
      • CASP-1 antibody
      • CASP1 antibody
      • CASP1_HUMAN antibody
      • Caspase 1 apoptosis related cysteine peptidase antibody
      • Caspase 1 apoptosis related cysteine protease antibody
      • Caspase-1 subunit p10 antibody
      • Caspase1 antibody
      • ICE antibody
      • IL 1 beta converting enzyme antibody
      • IL 1BC antibody
      • IL-1 beta-converting enzyme antibody
      • IL-1BC antibody
      • IL1 beta converting enzyme antibody
      • IL1B convertase antibody
      • IL1BC antibody
      • IL1BCE antibody
      • Interleukin 1 beta convertase antibody
      • Interleukin 1 beta convertase precursor antibody
      • Interleukin 1 beta converting enzyme antibody
      • Interleukin 1B converting enzyme antibody
      • Interleukin-1 beta convertase antibody
      • Interleukin-1 beta-converting enzyme antibody
      • P45 antibody
      see all

    Anti-Caspase-1 antibody images

    • Caspase-1 antibody (ab54932) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human hepatocellular carcinoma.

    • Western blot against tagged recombinant protein immunogen using ab54932 Caspase-1 antibody at 1ug/ml. Predicted band size of immunogen is 34 kDa

    References for Anti-Caspase-1 antibody (ab54932)

    This product has been referenced in:
    • Chen Y  et al. MicroRNAs 221/222 and genistein-mediated regulation of ARHI tumor suppressor gene in prostate cancer. Cancer Prev Res (Phila) 4:76-86 (2011). WB ; Human . Read more (PubMed: 21071579) »

    See 1 Publication for this product

    Product Wall

    Thank you for contacting us.
    I am sorry to hear you are experiencing difficulties with our products. We take product complaints very seriously, and investigate every product that we feel may not be performing correctly.
    I am attaching our que...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"