Anti-Caspase-3 antibody (ab90437)
Key features and details
- Rabbit polyclonal to Caspase-3
- Suitable for: WB, IHC-P
- Reacts with: Human, Saccharomyces cerevisiae
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-Caspase-3 antibody
See all Caspase-3 primary antibodies -
Description
Rabbit polyclonal to Caspase-3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Saccharomyces cerevisiae -
Immunogen
Recombinant full length protein corresponding to Human Caspase-3 aa 1-277.
Sequence:MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF SFDATFHAKKQIPCIVSMLTKELYFYH
Database link: P42574 -
Positive control
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Affinity Purification -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Assay kits
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab90437 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (7) |
1/1000. Predicted molecular weight: 32 kDa.
A lower molecular weight band refers to a proteolytic cleavage product of caspase-3. |
IHC-P |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/1000. Predicted molecular weight: 32 kDa. A lower molecular weight band refers to a proteolytic cleavage product of caspase-3. |
IHC-P
Use at an assay dependent concentration. |
Target
-
Function
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-
-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. -
Tissue specificity
Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system. -
Sequence similarities
Belongs to the peptidase C14A family. -
Post-translational
modificationsCleavage by granzyme B, caspase-6, caspase-8 and caspase-10 generates the two active subunits. Additional processing of the propeptides is likely due to the autocatalytic activity of the activated protease. Active heterodimers between the small subunit of caspase-7 protease and the large subunit of caspase-3 also occur and vice versa.
S-nitrosylated on its catalytic site cysteine in unstimulated human cell lines and denitrosylated upon activation of the Fas apoptotic pathway, associated with an increase in intracellular caspase activity. Fas therefore activates caspase-3 not only by inducing the cleavage of the caspase zymogen to its active subunits, but also by stimulating the denitrosylation of its active site thiol. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 836 Human
- Omim: 600636 Human
- SwissProt: P42574 Human
- Unigene: 141125 Human
-
Alternative names
- A830040C14Rik antibody
- Apopain antibody
- CASP 3 antibody
see all
Images
-
All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution
Lane 1 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 0 hours
Lane 2 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 12 hours
Developed using the ECL technique.
Predicted band size: 32 kDa
Observed band size: 32 kDa
Exposure time: 20 secondsBlocking with 5% milk for 1 hour at 23°C.
-
Immunohistochemistry analysis of human spleen tissue stained with Caspase-3, pAb at 10µg/ml.
-
All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : Jurkat cells treated with staurosporine
Lane 3 : MCF-7 cell lysate (negative control)
Developed using the ECL technique.
Predicted band size: 32 kDa
Additional bands at: ~18 kDa (possible cleavage fragment), ~20 kDa (possible cleavage fragment)Western blot analysis of Caspase-3 pAb.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (103)
ab90437 has been referenced in 103 publications.
- Patel S et al. Chondroprotective effects of multiple PRP injections in osteoarthritis by apoptosis regulation and increased aggrecan synthesis- Immunohistochemistry based Guinea pig study. J Clin Orthop Trauma 25:101762 (2022). PubMed: 35070686
- Zhang T et al. Hsa_circ_0005100 regulates tumorigenicity of colorectal carcinoma via miR-145-5p/MACC1 axis. J Clin Lab Anal 36:e24533 (2022). PubMed: 35766445
- Xu W et al. PIK3CB promotes oesophageal cancer proliferation through the PI3K/AKT/mTOR signalling axis. Cell Biol Int 46:1399-1408 (2022). PubMed: 35842767
- Zhang G et al. KDELR2 knockdown synergizes with temozolomide to induce glioma cell apoptosis through the CHOP and JNK/p38 pathways. Transl Cancer Res 10:3491-3506 (2021). PubMed: 35116653
- Gan YR et al. Dickkopf-1/cysteine-rich angiogenic inducer 61 axis mediates palmitic acid-induced inflammation and apoptosis of vascular endothelial cells. Mol Med Rep 23:N/A (2021). PubMed: 33300071