Anti-Claudin 17 antibody - BSA and Azide free (ab23333)

thank you for your fast answer - this result is also what I suspected. I wanted to ask you how you consider an antibody to fit to an antigen - is there some application or some value. I am aligning the synthetic peptides with ClustalW to my aminoacid sequence but I do not know when something "fits" or not. I would be very thankful if you could give me some short clue or direction.

Once again, thank you!

ANSWER:

Thank you for getting back to me.

Generally if an immunogen forms an alignment of 6 or more consecutive residues I would consider it possible that the antibody would react against the homolog of the species. However, if it is a polyclonal antisera this is not always the case as given its polyclonal nature it is a mixture of immunoglobulin molecules. I would be very interested to know the results of your sequence comparisons as I could not find an immunogen that carried significant sequence similarity to warrant the suggestion of the application of the antibody to fish.

I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

I am searching for a polyclonal antibody which would recognize the following fish specific isoform of claudin with the sequence:

MVSAGLQMLGTALAIIGWLGSIIICALPMWKVTAFIGANIVTAQVIWEGLWMNCVTQSTGQMQCKVYDSLLA LPQDLQAARALIIIAIIAGVFAILLGIAGGKCTNFVDNERSKAKVAIASGVVFLIAALLVLVPVCWSANTII RDFYNPLLVEAQRRELGASLYIGWGSAGLMILGGALLCCSCPPKDENHNVKYSKAASSVAGSSKAYV

Do you have a claudin antibody which would recognize this protein?

Thank you very much in advance!

ANSWER:

Thank you for your enquiry.

I have performed a sequence analysis of your fish sequence with all of immunogens used to raise our antibodies against Claudin. Unfortunately none had significant sequence similarity that would make me consider reactivity likely.

I am sorry that I cannot be of more assistance on this occasion.