You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Cyclin D1 protein (Tagged-His Tag) (ab92236)

Overview

  • Product nameCyclin D1 protein (Tagged-His Tag)See all Cyclin D1 proteins and peptides ...
  • Protein descriptionRecombinant full length protein, corresponding to amino acids 1-295 of Human Cyclin D1, with N terminal His tag, 295 amino acids. In addition to the coding region for Cyclin D1 this protein carries the following N-terminal sequence: MRGSHHHHHHGSYLGDTIESSTLDLGCHSVERAVGAVAASSRVRTLRRGAEEREGARGSRSESRARTQPGPTALPSCPGRAPA MWt 43kDa for total protein, (34kDa predicted from sequence of Cyclin D1). Uniprot: P24385.
  • Expression hostE. coli
  • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitution with 87 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesMEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAP SVSYFKCVQKEVLP SMRKIVATWMLEVCEEQKCEEEVF PLAMNYLDRFLSLEPVKKSRLQLLGATCMF VASKMKET IPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMT PHDFIE HFLSKMPEAEENKQIIRKHAQTFVALCATDVK FISNPPSMVAAGSVVAAVQGLN LRSPNNFLSYYRLTRF LSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKA AEEEEEEEEEVDLACTPTDVRDVDI
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab92236 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        AI327039B cell CLL/lymphoma 1B cell leukemia 1
        B cell lymphoma 1 proteinB-cell lymphoma 1 proteinBCL 1BCL-1BCL-1 oncogeneBCL1BCL1 oncogeneccnd1CCND1/FSTL3 fusion gene, includedCCND1/IGHG1 fusion gene, includedCCND1/IGLC1 fusion gene, includedCCND1/PTH fusion gene, includedCCND1_HUMANcD1Cyl 1D11S287EG1/S specific cyclin D1G1/S-specific cyclin-D1Parathyroid adenomatosis 1PRAD1PRAD1 oncogeneU21B31
      see all
  • FunctionEssential for the control of the cell cycle at the G1/S (start) transition.
  • Involvement in diseaseNote=A chromosomal aberration involving CCND1 may be a cause of B-lymphocytic malignancy, particularly mantle-cell lymphoma (MCL). Translocation t(11;14)(q13;q32) with immunoglobulin gene regions. Activation of CCND1 may be oncogenic by directly altering progression through the cell cycle.
    Note=A chromosomal aberration involving CCND1 may be a cause of parathyroid adenomas. Translocation t(11;11)(q13;p15) with the parathyroid hormone (PTH) enhancer.
    Defects in CCND1 are a cause of multiple myeloma (MM) [MIM:254500]. MM is a malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. Note=A chromosomal aberration involving CCND1 is found in multiple myeloma. Translocation t(11;14)(q13;q32) with the IgH locus.
  • Sequence similaritiesBelongs to the cyclin family. Cyclin D subfamily.
  • Post-translational
    modifications
    Phosphorylation at Thr-286 by MAP kinases is required for ubiquitination and degradation following DNA damage. It probably plays an essential role for recognition by the FBXO31 component of SCF (SKP1-cullin-F-box) protein ligase complex.
    Ubiquitinated, primarily as 'Lys-48'-linked polyubiquitination. Ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex containing FBXO4 and CRYAB (By similarity). Following DNA damage it is ubiquitinated by some SCF (SKP1-cullin-F-box) protein ligase complex containing FBXO31. Ubiquitination leads to its degradation and G1 arrest. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localizationNucleus.
  • Target information above from: UniProt accession P24385 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Cyclin D1 protein (Tagged-His Tag) images

    • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Cyclin D1 protein (Tagged-His Tag) (ab92236)

    ab92236 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab92236.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"