You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameKIAA1967 protein (Tagged-His Tag)See all KIAA1967 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 772-923 (152 aa) of Human KIAA1967 with a N terminal His tag; predicted MWt 19kDa (NP_066997.3).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 146 µl distilled water.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLIN VGSLLQRAEQQDSG RLYLENKIHTLELKLEESHNRFSA TEVTNKTLAAEMQELRVRLAEAEETARTAE RQKSQLQR LLQELRRRLTPLQLEIQRVVEKADSWVEKEEPAPSN
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91832 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        BA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A))DBC 1DBC.1
        DBC1DBC1_HUMANDBCCR1Deleted in bladder cancer chromosome region candidate 1Deleted in bladder cancer protein 1Deleted in breast cancer 1Deleted in breast cancer gene 1 proteinFAM5AIB3089AKIAA1967OTTHUMP00000022751p30 DBCp30 DBC proteinProtein FAM5A
      see all
  • FunctionCore component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. Inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediated apoptosis. Inhibits SUV39H1 methyltransferase activity.
  • Tissue specificityExpressed ubiquitously in normal tissues. Expressed in 84 to 100% of neoplastic breast, lung, and colon tissues.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession Q8N163 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    KIAA1967 protein (Tagged-His Tag) images

    • SDS-PAGE - KIAA1967 protein (Tagged-His Tag) (ab91832)
      SDS-PAGE - KIAA1967 protein (Tagged-His Tag) (ab91832)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for KIAA1967 protein (Tagged-His Tag) (ab91832)

    ab91832 has not yet been referenced specifically in any publications.

    Publishing research using ab91832 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91832 Submit a Question for ab91832

    There are currently no Abreviews or Questions for ab91832.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"