You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

DDAH2 protein (Tagged-His Tag) (ab92017)

Submit an Abreview Q&A (2)

Overview

  • Product nameDDAH2 protein (Tagged-His Tag)See all DDAH2 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 71-261 (191 amino acids) of Human DDAH2 with N terminal His tag; MWt 22kDa (UniProt O95865).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 53 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGD ENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSG PSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAA ADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92017 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        DDAHDDAH IIDDAH-2
        DDAH2DDAH2_HUMANDDAHIIDimethylargininase 2Dimethylargininase-2Dimethylarginine dimethylaminohydrolase 2Dimethylarginine dimethylaminohydrolase IIG6aN(G),N(G)-dimethylarginine dimethylaminohydrolase 2NG dimethylarginine dimethylamino hydrolase homologNG30OTTHUMP00000029307OTTHUMP00000029310OTTHUMP00000174488OTTHUMP00000174489Protein G6aS phase proteinS-phase protein
      see all
  • FunctionHydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
  • Tissue specificityDetected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
  • Sequence similaritiesBelongs to the DDAH family.

    • Target information above from: UniProt accession O95865 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    DDAH2 protein (Tagged-His Tag) images

    • SDS-PAGE - DDAH2 protein (Tagged-His Tag) (ab92017)
      SDS-PAGE - DDAH2 protein (Tagged-His Tag) (ab92017)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for DDAH2 protein (Tagged-His Tag) (ab92017)

    ab92017 has not yet been referenced specifically in any publications.

    Publishing research using ab92017 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92017 Submit a Question for ab92017

    Displaying 1 - 2 of 2 results for Abreviews and Q&A

    10
    Votes: Highest First

    Please see customers response below:

    I am also looking for recombinant protein to use as positive control in western blot for eNOS/NOS3, eNOS/NOS3 phosphorylated on serine 1177, DDAH1 and DDAH2.

    The western blot will be done in denat...

    Read More

    Thank you for your response.

    I have conducted a search for your customer and found the following products in our catalogue.

    ab109090: eNOS/NOS3 - C terminal peptide, though it has not been tested in Western blot application; it was the...

    Read More

    We have a customer who is looking for recombinant protein to use as positive control in western blot for eNOS/NOS3, eNOS/NOS3 phosphorylated on serine 1177, DDAH1 and DDAH2. Do you have this product?

    Thank you for contacting us.

    We have:

    DDAH1 protein (http://www.abcam.com/ab99863), Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag.
    DDAH2 protein (Tagged-His Tag) (http://www.abcam.com/ab92017), Re...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"