You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

DDB2 protein (Tagged-His Tag) (ab91908)

Submit an Abreview Q&A (1)

Overview

  • Product nameDDB2 protein (Tagged-His Tag)See all DDB2 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1-261 (261 amino acids) of Human DDB2 with an N terminal His tag. Predicted MWt: 30kDa, UniProt ID: Q92466.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 59 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesMAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAK GSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGR ASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSIT GLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTI NIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM HKKKVTHVALNPCCDWFLATA
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91908 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        damage-specific DNA binding protein 2Damage-specific DNA-binding protein 2DDB p48 subunit
        Ddb2DDB2_HUMANDDBbDNA damage-binding protein 2UV-damaged DNA-binding protein 2UV-DDB 2
      see all
  • FunctionRequired for DNA repair. Binds to DDB1 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as the substrate recognition module for the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex DDB1-CUL4-ROC1 (also known as CUL4-DDB-ROC1 and CUL4-DDB-RBX1). The DDB1-CUL4-ROC1 complex may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. The DDB1-CUL4-ROC1 complex also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. Isoform D1 and isoform D2 inhibit UV-damaged DNA repair.
  • Tissue specificityUbiquitously expressed; with highest levels in corneal endothelium and lowest levels in brain. Isoform D1 is highly expressed in brain and heart. Isoform D2, isoform D3 and isoform D4 are weakly expressed.
  • PathwayProtein modification; protein ubiquitination.
  • Involvement in diseaseDefects in DDB2 are a cause of xeroderma pigmentosum complementation group E (XP-E) [MIM:278740]; also known as xeroderma pigmentosum V (XP5). XP-E is a rare human autosomal recessive disease characterized by solar sensitivity, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities.
  • Sequence similaritiesBelongs to the WD repeat DDB2/WDR76 family.
    Contains 5 WD repeats.
  • DomainThe DWD box is required for interaction with DDB1.
  • Post-translational
    modifications    Phosphorylation by ABL1 negatively regulate UV-DDB activity.
    Ubiquitinated by CUL4A in response to UV irradiation. Ubiquitination appears to both impair DNA-binding and promotes ubiquitin-dependent proteolysis. Degradation of DDB2 at sites of DNA damage may be a prerequisite for their recognition by XPC and subsequent repair. CUL4A-mediated degradation appears to be promoted by ABL1.
  • Cellular localizationNucleus. Accumulates at sites of DNA damage following UV irradiation.

    • Target information above from: UniProt accession Q92466 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    DDB2 protein (Tagged-His Tag) images

    • SDS-PAGE - DDB2 protein (Tagged-His Tag) (ab91908)
      SDS-PAGE - DDB2 protein (Tagged-His Tag) (ab91908)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for DDB2 protein (Tagged-His Tag) (ab91908)

    ab91908 has not yet been referenced specifically in any publications.

    Publishing research using ab91908 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91908 Submit a Question for ab91908

    Displaying 1 - 1 of 1 results for Abreviews and Q&A

    10
    Votes: Highest First

    Bonjour,

    Je vous contacte car j’ai rencontré un problème au cours de mes expériences en utilisant une de vos protéines purifiées.

    L’expérience que j’ai faite, c’éta...

    Read More

    Nous n'avons malheureusement pas assez d'expertise pour répondre précisement à ce problème et cette application n'a pas été utilisée avec cette protéine. Je pense néanmoins que la DDB2 devrait...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"