Anti-Deep Orange antibody (ab21872)

Overview

• Product nameAnti-Deep Orange antibody
• Description
  Mouse polyclonal to Deep Orange
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Fruit fly (Drosophila melanogaster)
  
• Immunogen

  Fusion protein: AKETASRPSDSKIRRKLWLRIAYHDIKGTNDVKKALNLLK ECDLLRIEDLLPFFADFEKIDNFKEAICDALRDYNQRIQE LQREMAETTEQTDRVTAELQ, corresponding to amino acids 771/870 of Drosophila melanogaster Deep Orange .

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Signal Transduction
  • Protein Trafficking
  • Organelle Proteins

  • Neuroscience
  • Sensory System
  • Visual system

Applications

Target

• RelevanceDeep Orange is required for the biogenesis of eye pigment granules. It plays a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Deep Orange is expressed both maternally and zygotically in all stages of development. Highest expression is in third larval instar. It is a member of the 'granule group' of eye color genes as mutants affect deposition in pigment granules of two types of pigments, the ommochromes and drosopterins.
• Cellular localizationCytoplasmic; peripheral membrane protein associated with late endosomes/lysosomes.
• Database links
  • Entrez Gene: 31118 Fruit fly (Drosophila melanogaster)
  • SwissProt: Q24314 Fruit fly (Drosophila melanogaster)

• Alternative names
  CG3093 antibodyDeep orange protein antibodydor antibody

  dor1 antibodyVacuolar protein sorting 18 antibody

  see all

Anti-Deep Orange antibody images

• 

  Western blot - Deep Orange antibody (ab21872)
  All lanes : Anti-Deep Orange antibody (ab21872) at 1/1000 dilution
  
  Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
  Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution
  
  Predicted band size : 115 kDa