You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-Deep Orange antibody (ab21872)

Overview

  • Product nameAnti-Deep Orange antibody
  • Description
    Mouse polyclonal to Deep Orange
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Fruit fly (Drosophila melanogaster)
  • Immunogen

    Fusion protein: AKETASRPSDSKIRRKLWLRIAYHDIKGTNDVKKALNLLK ECDLLRIEDLLPFFADFEKIDNFKEAICDALRDYNQRIQE LQREMAETTEQTDRVTAELQ, corresponding to amino acids 771/870 of Drosophila melanogaster Deep Orange .

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab21872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB
  • Application notesWB: 1/1000. Predicted molecular weight: 115 kDa.

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
  • Target

    • RelevanceDeep Orange is required for the biogenesis of eye pigment granules. It plays a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Deep Orange is expressed both maternally and zygotically in all stages of development. Highest expression is in third larval instar. It is a member of the 'granule group' of eye color genes as mutants affect deposition in pigment granules of two types of pigments, the ommochromes and drosopterins.
    • Cellular localizationCytoplasmic; peripheral membrane protein associated with late endosomes/lysosomes.
    • Database links
      • Alternative names
          CG3093 antibodyDeep orange protein antibodydor antibody
          dor1 antibodyVacuolar protein sorting 18 antibody
        see all

      Anti-Deep Orange antibody images

      • All lanes : Anti-Deep Orange antibody (ab21872) at 1/1000 dilution

        Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
        Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

        Secondary
        Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

        Predicted band size : 115 kDa

      References for Anti-Deep Orange antibody (ab21872)

      ab21872 has not yet been referenced specifically in any publications.

      Product Wall

      Displaying 1 - 4 of 4 results for Abreviews and Q&A

      Application Western blot
      Sample Fruit fly (Drosophila melanogaster) Tissue lysate - whole (Full larvae)
      Loading amount 40 µg
      Specification Full larvae
      Gel Running Conditions Reduced Denaturing
      Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
      Username

      Verified customer

      Submitted Jan 18 2012

      Thank you for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free...

      Read More

      Thank you for your reply. The antibody vial seems to be damaged somehow, maybe during storage or shipping. I am very sorry for this inconvenience. I do not know what exactly has happened. I suggest therefore that we do replace this vial for you. We have o...

      Read More

      Thank you for contacting us. I am sorry to hear you are experiencing difficulties with this antibody. We had so far no complaints about ab21872. We however take everyproduct complaint very seriously, and investigate every product that we feel may not be p...

      Read More

      Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"