You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameE2F2 proteinSee all E2F2 proteins and peptides ...
  • Protein descriptionRecombinant full length Human E2F2 (amino acids 1-83) with N terminal proprietary tag; Predicted MWt 35.24 kDa (UniProt Q96ID7; AAH07609).
  • Uniprot accessionQ96ID7
  • Molecular weight35.240kDa inclusive of tags
  • Protein length83 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • SequenceMESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDY RHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPK VLR
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114610 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        dE2F2E2F transcription factor 2E2F-2
        E2F2E2F2_HUMANTranscription factor E2F2
      see all
  • FunctionTranscription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner.
  • Tissue specificityHighest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
  • Sequence similaritiesBelongs to the E2F/DP family.
  • Post-translational
    modifications    Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession Q14209 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    E2F2 protein images

    • SDS-PAGE - E2F2 protein (ab114610)
      SDS-PAGE - E2F2 protein (ab114610)
      ab114610 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

    References for E2F2 protein (ab114610)

    ab114610 has not yet been referenced specifically in any publications.

    Publishing research using ab114610 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114610 Submit a Question for ab114610

    There are currently no Abreviews or Questions for ab114610.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"