Overview

  • Product nameAnti-EGFR antibody
    See all EGFR primary antibodies
  • Description
    Rabbit polyclonal to EGFR
  • Tested applicationsWB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EGFR aa 1-403.
    Sequence:

    MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLS LQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIP LENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRF SNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCW GAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLV CRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE ITGLS


    Database link: P00533

  • Positive control
    • A431 cell lysate, EGFR transfected 293T cell line lysate, HeLa cells.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab103575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 134 kDa.
ICC/IF 1/1200.

Target

  • Information by UniProt
  • Database links
  • Alternative names
    • Avian erythroblastic leukemia viral (v erb b) oncogene homolog antibody
    • Cell growth inhibiting protein 40 antibody
    • Cell proliferation inducing protein 61 antibody
    • EGF R antibody
    • EGFR antibody
    • EGFR_HUMAN antibody
    • Epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) antibody
    • Epidermal growth factor receptor (erythroblastic leukemia viral (v erb b) oncogene homolog avian) antibody
    • Epidermal growth factor receptor antibody
    • erb-b2 receptor tyrosine kinase 1 antibody
    • ERBB antibody
    • ERBB1 antibody
    • Errp antibody
    • HER1 antibody
    • mENA antibody
    • NISBD2 antibody
    • Oncogen ERBB antibody
    • PIG61 antibody
    • Proto-oncogene c-ErbB-1 antibody
    • Receptor tyrosine protein kinase ErbB 1 antibody
    • Receptor tyrosine-protein kinase ErbB-1 antibody
    • SA7 antibody
    • Species antigen 7 antibody
    • Urogastrone antibody
    • v-erb-b Avian erythroblastic leukemia viral oncogen homolog antibody
    • wa2 antibody
    • Wa5 antibody
    see all

Anti-EGFR antibody images

  • Anti-EGFR antibody (ab103575) at 1/500 dilution + A431 cell lysate at 50 µg

    Predicted band size : 134 kDa
  • All lanes : Anti-EGFR antibody (ab103575) at 1/500 dilution

    Lane 1 : EFGR transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 25 µg per lane.


    Predicted band size : 134 kDa

References for Anti-EGFR antibody (ab103575)

ab103575 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us and your interest in our products.

We have a number of antibodies which may be suitable for your needs but I was not able to find any reference for any of them for use in live cell imaging and I would therefor not ...

Read More

Thank you for contacting us.

We have 46 polyclonal EGFR antibodies in our catalog, three of which are raised against the extracellular domain (residues 25 - 645):

ab15669 (http://www.abcam.com/EGFR-antibody-ab15669.html)
ab103...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"