Anti-EID1 antibody [26] (ab78323)
Key features and details
- Mouse monoclonal [26] to EID1
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-EID1 antibody [26]
See all EID1 primary antibodies -
Description
Mouse monoclonal [26] to EID1 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Cynomolgus monkey, Orangutan -
Immunogen
Synthetic peptide:
YEKTPFDQLAFIEELFSLMVVNRLTEELGC
, corresponding to amino acids 159 - 187 of Human EID1 -
Positive control
- extracts from MCF7 cells transfected with EID1
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Ion Exchange Chromatography -
Purification notes
ab78323 was purified by propriety chromatography under mild conditions as IgG fraction from serum free growth medium of mouse hybridoma clone and sterilized by filtration. -
Clonality
Monoclonal -
Clone number
26 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab78323 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 1 - 5 µg/ml.
|
|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa.
|
Notes |
---|
ICC/IF
Use a concentration of 1 - 5 µg/ml. |
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa. |
Target
-
Function
Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms. -
Tissue specificity
Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A549 and various leukemia cell lines. -
Developmental stage
Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level). -
Post-translational
modificationsUbiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit. -
Cellular localization
Nucleus. Cytoplasm. May shuttle between nucleus and cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23741 Human
- Omim: 605894 Human
- SwissProt: Q9Y6B2 Human
- Unigene: 255973 Human
-
Alternative names
- 21 kDa pRb associated protein antibody
- 21 kDa pRb-associated protein antibody
- C15orf3 antibody
see all
Images
-
ab78323 staining EID1 in HeLA cells by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with 4% paraformaldehyde, permeabilized with Triton X-100 0.25% in PBS and blocked with 1.5% BSA for 30 minutes. Samples were incubated with primary antibody (1/100 in PBS + 1% BSA) overnight at 4°C. An Alexa Fluor®488-conjugated Goat anti-mouse IgG polyclonal (1/1000 in PBS + 1% BSA) was used as the secondary antibody incubated for 1 hour. DAPI was used to stain the nuclear DNA.
-
All lanes : Anti-EID1 antibody [26] (ab78323) at 1 µg/ml
Lane 1 : extracts from MCF7 cells transfected with control
vector pCMV1
Lane 2 : extracts from MCF7 cells transfected with the EID1 expression
vector pcDNA3/EID1
Secondary
All lanes : HRP-conjugated mouse IgG
Predicted band size: 21 kDa
Observed band size: 21 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab78323 has not yet been referenced specifically in any publications.