Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Cell Biology >> Apoptosis >> Intracellular >> Associated Proteins
Anti-EID1 antibody
See all EID1 products (2) ...
Mouse monoclonal to EID1
ELISA, WBmore details
Reacts with
Mouse, Rat, Human
Predicted to work with
Cow, Cynomolgus Monkey, Orangutan
Synthetic peptide: YEKTPFDQLAFIEELFSLMVVNRLTEELGC, corresponding to amino acids 159 - 187 of Human EID1
YEKTPFDQLA FIEELFSLMV VNRLTEELGC
extracts from MCF7 cells transfected with EID1
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 50% Glycerol, PBS, pH 7.4
Concentration information loading...
IgG fraction
ab78323 was purified by propriety chromatography under mild conditions as IgG fraction from serum free growth medium of mouse hybridoma clone and sterilized by filtration.
Monoclonal
IgG2a
kappa
Cancer >> Oncoproteins/suppressors >> Tumor suppressors >> Rb family
Epigenetics and Nuclear Signaling >> Chromatin Modifying Enzymes >> Acetylation >> HAT
Epigenetics and Nuclear Signaling >> Transcription >> Transcription Factors
Epigenetics and Nuclear Signaling >> Transcription >> Other factors
Signal Transduction >> Second Messenger >> Nucleotide Messenger >> cAMP
Epigenetics and Nuclear Signaling >> Chromatin Modifying Enzymes >> Acetylation
Cell Biology >> Apoptosis >> Intracellular >> Associated Proteins
Western blot - EID1 antibody [26] (ab78323)
(enlarge)
Our Abpromise guarantee covers the use of ab78323 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
ELISA: Use at an assay dependent dilution.
WB: Use a concentration of 1 µg/mlPredicted molecular weight: 21 kDa.
Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.
Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A549 and various leukemia cell lines.
Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level).
Ubiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit.
Nucleus. Cytoplasm. May shuttle between nucleus and cytoplasm.
Target information above from: UniProt accessionQ9Y6B2
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Western blot - EID1 antibody [26] (ab78323)
All lanes : Anti-EID1 antibody (ab78323) at 1 µg/ml
Lane 1 : extracts from MCF7 cells transfected with control
vector pCMV1
Lane 2 : extracts from MCF7 cells transfected with the EID1 expression
vector pcDNA3/EID1
Secondary
HRP-conjugated mouse IgG
Predicted band size : 21 kDa
Observed band size : 21 kDa
ab78323 has not yet been referenced specifically in any publications.
Publishing research using ab78323? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:
All lanes : Anti-EID1 antibody (ab78323) at 1 µg/ml
Lane 1 : extracts from MCF7 cells transfected with control
vector pCMV1
Lane 2 : extracts from MCF7 cells transfected with the EID1 expression
vector pcDNA3/EID1
Secondary
HRP-conjugated mouse IgG
Predicted band size : 21 kDa
Observed band size : 21 kDa
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
