Overview

  • Product nameAnti-EMSY antibodySee all EMSY primary antibodies ...
  • Description
    Goat polyclonal to EMSY
  • SpecificityThis antibody detects a band of the same size by Western blot as ab123, which was raised with a recombinant fragment of EMSY with no sequence in common with the immunogen for this antibody (and was raised 7 years previous to this antibody). This confirms that the band detected is EMSY.
  • Tested applicationsICC/IF, WB, ICCmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to EMSY ENT domain:

    MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLG ELSKVLSISTER HRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRL

    , corresponding to amino acids 1-100 of Human EMSY - FPLC purified.

  • Positive control
    • MCF-7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab4579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent dilution.
WB 1/500. Predicted molecular weight: 141 kDa.
ICC Use at an assay dependent dilution.

Target

  • RelevanceEMSY binds BRCA2 within a region (exon 3) deleted in cancer. EMSY is capable of silencing the activation potential of BRCA2 exon 3, associates with chromatin regulators HP1 and BS69, and localizes to sites of repair following DNA damage. Its levels are amplified in breast and ovarian cancer.
  • Cellular localizationNuclear. Localizes to DNA damage markers in irradiated cells; suggesting that it participates in the DNA repair process.
  • Database links
  • Alternative names
    • C11orf30 antibody
    • Chromosome 11 open reading frame 30 antibody
    • EMSY protein antibody
    • FLJ90741 antibody
    • GL002 antibody
    • Protein EMSY antibody
    see all

Anti-EMSY antibody images

  • Lanes 1 - 2 : Anti-EMSY antibody (ab4579) at 1 µg/ml
    Lane 3 : Anti-EMSY antibody (ab123) at 1 µg/ml

    Lane 1 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate
    Lane 3 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    Lanes 1 - 2 : Rabbit polyclonal to Goat IgG - H&L - Pre-Adsorbed (HRP) at 1/10000 dilution
    Lane 3 : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/50000 dilution

    developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 141 kDa
    Observed band size : 100 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 37 kDa,70 kDa. We are unsure as to the identity of these extra bands.

    Exposure time : 2 minutes

    Western blot of EMSY on MCF-7 cell lysate.

    Lane 1: ab4579 at 1ug/ml with 2% BSA blocking.

    Lane 2: ab4579 at 1ug/ml with 3% milk blocking.

    Lane 3: ab123 at 1ug/ml with 2% BSA blocking.

    Variability in the size at which EMSY runs by Western blot has been experienced with different protein marker systems. EMSY has been observed to run at between 115 and 150kD (even though the predicted size is 141kD). However, that the same size band is detected by both ab123 and ab4579 (raised with immunogens of different sequence) confirms the specificity of these antibodies.

     Lane 1 & 2 - Exposure time: 2 min.

    Lane 3 - Exposure time: 2 sec.

References for Anti-EMSY antibody (ab4579)

ab4579 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab4579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"