Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
Key features and details
- Mouse monoclonal [OTI3E3] to Ephrin A2
- Suitable for: Flow Cyt (Intra), WB, IHC-P, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2b
Overview
-
Product name
Anti-Ephrin A2 antibody [OTI3E3] -
Description
Mouse monoclonal [OTI3E3] to Ephrin A2 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt (Intra), WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human Ephrin A2 aa 1-213. Produced in HEK293T cells (NP_001396).
Sequence:MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Database link: O43921 -
Positive control
- WB: HEK293T cells transfected pCMV6-ENTRY Ephrin A2 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF:COS7 cells transiently transfected by pCMV6-ENTRY Ephrin A2. Flow Cyt (Intra): Jurkat cells.
-
General notes
The clone number has been updated from 3E3 to OTI3E3, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3E3 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab123877 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt (Intra) |
1/100.
ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody. |
|
WB |
1/2000. Predicted molecular weight: 24 kDa.
|
|
IHC-P |
1/150.
|
|
ICC/IF |
1/100.
|
Notes |
---|
Flow Cyt (Intra)
1/100. ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody. |
WB
1/2000. Predicted molecular weight: 24 kDa. |
IHC-P
1/150. |
ICC/IF
1/100. |
Target
-
Sequence similarities
Belongs to the ephrin family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1943 Human
- Omim: 602756 Human
- SwissProt: O43921 Human
- Unigene: 532655 Human
-
Alternative names
- EFNA 2 antibody
- efna2 antibody
- EFNA2_HUMAN antibody
see all
Images
-
COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Ephrin A2, stained for Epherin A2 (Green) using ab123877 at 1/100 dilution in ICC/IF.
-
All lanes : Anti-Ephrin A2 antibody [OTI3E3] (ab123877) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY Ephrin A2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa -
Paraffin-embedded human endometrium tissue stained for Ephrin A2 using ab123877 at 1/100 dilution in immunohistochemical analysis.
-
ab123877 at 1/100 dilution staining Ephrin-A2 in Jurkat cells by Flow Cytometry (Intracellular) (Red) compared to a nonspecific negative control antibody (Blue).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab123877 has not yet been referenced specifically in any publications.