You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameErbB 2 proteinSee all ErbB 2 proteins and peptides ...
  • Protein descriptionRecombinant fragment: GQECVEECRV LQGLPREYVN ARHCLPCHPE CQPQNGSVTC FGPEADQCVA CAHYKDPPFC VARCPSGVKP DLSYMPIWKF PDEEGACQPC P with GST tag, corresponding to amino acids 537-636 of Human ErbB 2
  • Expression hostE. coli
  • Properties

  • Purification notesab40048 is purified.
  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
  • Concentration information loading...
  • Sequence notesGQEC VEECRVLQGL PREYVNARHC LPCHPECQPQ NGSVTCFGPE ADQCVACAHY KDPPFCVARC PSGVKPDLSY MPIWKFPDEE GACQPCPINC THSCVD
  • SequenceGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTC FGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKF PDEEGACQPCP
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab40048 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent dilution.
    Inhibition Assay Inhib: Use at an assay dependent dilution.
    SDS-PAGE SDS-PAGE: Use at an assay dependent dilution. On SDS-PAGE commassie blue stained gel, the purified recombinant protein shows a band at 37kDa.
    WB WB: Use at an assay dependent dilution.

    Protein info

    • Alternative names
        Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homologc erb B2C erb B2/neu protein
        C erbB 2C-erbB2CD340CD340 antigenCerb B2/neu proteinCerbB2Erb B2erbb2ERBB2_HUMANHER 2HER 2/neuHER2Her2/neuHerstatinMetastatic lymph node gene 19 proteinMLN 19MLN19NEUNEU Proto OncogeneNeuro Glioblastoma Derived Oncogene HomologNeuroblastoma/glioblastoma derived oncogene homologNGLp185 ErbB2p185erbB2Proto-oncogene c-ErbB-2Proto-oncogene NeuReceptor Protein Tyrosine Kinase ErbB2 PrecursorReceptor tyrosine protein kinase erbB 2Receptor tyrosine-protein kinase erbB-2TKR1Tyrosine kinase type cell surface receptor HER2Tyrosine kinase-type cell surface receptor HER2V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog)v erb b2 erythroblastic leukemia viral oncogene homolog 2 neuro/glioblastoma derived oncogene homolog (avian)V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
      see all
  • FunctionProtein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
    In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
  • Tissue specificityExpressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth.
  • Involvement in diseaseHereditary diffuse gastric cancer (HDGC) [MIM:137215]: A cancer predisposition syndrome with increased susceptibility to diffuse gastric cancer. Diffuse gastric cancer is a malignant disease characterized by poorly differentiated infiltrating lesions resulting in thickening of the stomach. Malignant tumors start in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. Note=The gene represented in this entry is involved in disease pathogenesis.
    Glioma (GLM) [MIM:137800]: Gliomas are benign or malignant central nervous system neoplasms derived from glial cells. They comprise astrocytomas and glioblastoma multiforme that are derived from astrocytes, oligodendrogliomas derived from oligodendrocytes and ependymomas derived from ependymocytes. Note=The gene represented in this entry is involved in disease pathogenesis.
    Ovarian cancer (OC) [MIM:167000]: The term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Lung cancer (LNCR) [MIM:211980]: A common malignancy affecting tissues of the lung. The most common form of lung cancer is non-small cell lung cancer (NSCLC) that can be divided into 3 major histologic subtypes: squamous cell carcinoma, adenocarcinoma, and large cell lung cancer. NSCLC is often diagnosed at an advanced stage and has a poor prognosis. Note=The gene represented in this entry is involved in disease pathogenesis.
    Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease. Note=The gene represented in this entry is involved in disease pathogenesis.
    Note=Chromosomal aberrations involving ERBB2 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with CDK12, leading to CDK12-ERBB2 fusion leading to truncated CDK12 protein not in-frame with ERBB2.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Ligand-binding increases phosphorylation on tyrosine residues. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Signaling via SEMA4C promotes phosphorylation at Tyr-1248.
  • Cellular localizationCytoplasm. Nucleus and Cell membrane. Cytoplasm > perinuclear region. Nucleus. Translocation to the nucleus requires endocytosis, probably endosomal sorting and is mediated by importin beta-1/KPNB1.
  • Target information above from: UniProt accession P04626 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    References for ErbB 2 protein (ab40048)

    ab40048 has not yet been referenced specifically in any publications.

    Product Wall

    Displaying 1 - 2 of 2 results for Abreviews and Q&A

    Vielen Dank für Ihren Anruf und Ihre Anfrage. Ich habe nun Antwort aus dem Labor bekommen und muss Ihnen leider bestätigen, dass beide Produkte während des Aufreinigungs-Prozess denaturiert werden und dann in Acetatbuffer wieder gefaltet werden. ...

    Read More

    Gracias por ponerse en contacto con nosotros. Le confirmo que el GST tag está unido al extremo N-terminal de la proteína. Espero haber contestado su pregunta. Por favor, no dude en contactarme para cualquier otra duda o sugerencia.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"