Anti-CTRP12 antibody (ab121791)
Key features and details
- Rabbit polyclonal to CTRP12
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CTRP12 antibody -
Description
Rabbit polyclonal to CTRP12 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CTRP12 aa 70-138.
Sequence:DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLH EFQELLKEATERRFSGLLD
-
Positive control
- IHC: Human colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121791 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the FAM132 family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 388581 Human
- SwissProt: Q5T7M4 Human
- Unigene: 197613 Human
-
Alternative names
- Adipolin antibody
- Adipose derived insulin sensitizing factor antibody
- C1q domain containing 2 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab121791 has not yet been referenced specifically in any publications.