You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameFGF basic protein (Active)See all FGF basic proteins and peptides ...
  • Protein descriptionRecombinant full length Human FGF basic expressed in modified human 293 cells; amino acids 134-288 (155aa), Predicted MWt 16.4 kDa (Swiss-Prot P09038).
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityActivity: The ED50 of ab88394 is typically 0.05-0.1 ng/ml as measured in a cell proliferation assay using human umbilical endothelial cells (HUVECs).
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin
  • Concentration information loading...
  • Sequence notesMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFF LRIHPDGRVD GVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDE CFFFERLESNNYNTYR SRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLP MSAK S
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab88394 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    Functional Studies
  • Application notesFuncS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.

    Molecular Mass: Under reducing conditions ab88394 migrates as a band of approximately 15-17 kDa on SDS-PAGE. This compares with the predicted monomeric molecular mass of 16.4 kDa.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Basic fibroblast growth factorBasic fibroblast growth factor bFGFBFGF
        FGF 2FGF BFGF-2FGF2FGF2 basicFGF2_HUMANFGFBFibroblast growth factor 2Fibroblast growth factor 2 (basic)HBGF 2HBGF-2HBGF2HBGH 2HBGH2Heparin binding growth factor 2 precursorHeparin-binding growth factor 2Prostatropin
      see all
  • FunctionPlays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
  • Tissue specificityExpressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similaritiesBelongs to the heparin-binding growth factors family.
  • Post-translational
    modifications    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localizationSecreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.

    • Target information above from: UniProt accession P09038 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    FGF basic protein (Active) images

    • SDS-PAGE - FGF basic protein (Active) (ab88394)
      SDS-PAGE - FGF basic protein (Active) (ab88394)
      1D SDS-PAGE of ab88394 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1: ab88394
      Lane 2: ab88394 treated with PNGase F to remove potential N-linked glycans
      Lane 3: ab88394 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.

      Additional bands in lane 2 and lane 3 are glycosidase enzymes. The results suggest that ab88394 is not glycosylated.

    References for FGF basic protein (Active) (ab88394)

    ab88394 has not yet been referenced specifically in any publications.

    Publishing research using ab88394 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab88394 Submit a Question for ab88394

    There are currently no Abreviews or Questions for ab88394.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"