Loading...
Products:Epigenetics and Nuclear Signaling >> Transcription >> Domain Families >> Forkhead Box >> FOXA
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Anti-FOXA2 antibody
See all FOXA2 products (12) ...
Rabbit polyclonal to FOXA2
The winged helix transcription factor, FOXA2, is expressed in the foregut endoderm and in subsets of respiratory epithelial cells in the fetal and adult lung. It should be known that FOXA2 is not normally detected in wildtype tissue in western blot. A positive control for western blot would be a cell line that is over-expressing FOXA2, ie: transfected to over-express FOXA2.
IHC-Fr, WB, IHC-P, IHC-FoFr, ICC/IFmore details
Reacts with
Mouse, Rat, Human
Recombinant Fusion protein: MEGHEPSDWS SYYAEPEGYS SVSNMNASLG MNGMNTYMSM SAAAMGSGSG NMSAGSMNMS SYVGAGMSPS LAGMSPGAGA , corresponding to N terminal amino acids 7-86 of Rat FOXA2
MEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSM SAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGA
IHC: Adult mouse lung tissue. WB: transfected cells
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Preservative: 0.01% Sodium Azide
Constituents: Whole serum
Whole antiserum
Polyclonal
IgG
Metabolism >> Types of disease >> Obesity
Developmental Biology >> Lineage specification >> Endoderm
Stem Cells >> Lineage Markers >> Endoderm
Epigenetics and Nuclear Signaling >> Transcription >> Domain Families >> Forkhead Box >> FOXA
Our Abpromise guarantee covers the use of ab40874 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
IHC-Fr: 1/1000. Immerse sections in 10 mM sodium citrate, pH 6.0, and heat in a microwave for 15 min at 90%deg;C.Block sections in 2-4% normal serum in PBS + 0.2% Triton X-100 for 2 hr at room temperature.Incubate primary antibody in blocking buffer.
WB: 1/5000. Predicted molecular weight: 48 kDa.Block in 10% milk in TBST buffer (10 mM Tris-HCl, pH 7.4, 0.9% NaCl, 0.2% Tween20) 3 times 20 minutes.
IHC-P: 1/2000 - 1/4000. Perform heat mediated antigen retrieval via the microwave method before commencing with IHC staining protocol.
IHC-FoFr: Use at an assay dependent dilution.
ICC/IF: 1/1000.
Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). In embryonic development is required for notochord formation. Involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; FOXA1 and FOXA2 seem to have at least in part redundant roles. Originally discribed as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. Involved in regulation of fat metabolism. Binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation.
Contains 1 fork-head DNA-binding domain.
Phosphorylation on Thr-156 abolishes binding to target promoters and subsequent transcription activation upon insulin stimulation.
Nucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a CRM1-dependent manner and in response to insulin signaling via AKT1 is exported from the nucleus.
Target information above from: UniProt accessionQ9Y261
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - FOXA2 antibody (ab40874)

Immunohistochemistry. Adult mouse lung was embedded in paraffin and stained with ab40874 (1:2000 dilution). FOXA2 was visualized by DAB (black color) and counterstained with Nuclear Fast Red (pink color). Magnification 20x.
Immunohistochemistry (Frozen sections) - FOXA2 antibody (ab40874)

ab40874 at a 1/1000 dilution staining FOXA2 in rat midbrain tissue sections by Immunohistochemistry (frozen sections) incubated for 16 hours at 25°C. PFA fixed. Blocked with 5% serum for 1 hour at 25°C. Secondary used at 1/200 polyclonal Goat anti-rabbit conjugated to Alexa Fluor 488. DAPI staining (blue), FOXA2 staining (green).
This image is courtesy of an anonymous abreview.
Immunohistochemistry (PFA perfusion fixed frozen sections) - FOXA2 antibody (ab40874)

ab40874 staining FOXA2 in mouse embryo by Immunohistochemistry (PFA perfusion fixed frozen sections). Embryos were isolated, fixed for 20 minutes in 2% PFA in PBS, and then permeabilized in 0.1% Triton X-100 in 0.1 M glycine pH 8.0. After blocking in 10% FCS, 3% goat serum, 0.1% BSA, 0.1% Tween 20 for 2 hours, embryos were incubated with the primary antibody overnight at 4°C in blocking solution. After several washes in PBS containing 0.1% Tween-20 (PBST) samples were incubated with Donkey anti-rabbit 488 secondary antibodies.
A. E7.0 (Mid streak embryos) B. E7.0 (Late streak embryos)
Image from Burtscher Ingo et.al., Development. 2009 Mar;136(6):1029-38 Fig 1.
Immunocytochemistry/ Immunofluorescence - FOXA2 antibody (ab40874)

ICC/IF image of ab40874 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab40874, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This product has been referenced in:
See all 12 publications for this product
Publishing research using ab40874? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

Immunohistochemistry. Adult mouse lung was embedded in paraffin and stained with ab40874 (1:2000 dilution). FOXA2 was visualized by DAB (black color) and counterstained with Nuclear Fast Red (pink color). Magnification 20x.

ab40874 at a 1/1000 dilution staining FOXA2 in rat midbrain tissue sections by Immunohistochemistry (frozen sections) incubated for 16 hours at 25°C. PFA fixed. Blocked with 5% serum for 1 hour at 25°C. Secondary used at 1/200 polyclonal Goat anti-rabbit conjugated to Alexa Fluor 488. DAPI staining (blue), FOXA2 staining (green).
This image is courtesy of an anonymous abreview.

ab40874 staining FOXA2 in mouse embryo by Immunohistochemistry (PFA perfusion fixed frozen sections). Embryos were isolated, fixed for 20 minutes in 2% PFA in PBS, and then permeabilized in 0.1% Triton X-100 in 0.1 M glycine pH 8.0. After blocking in 10% FCS, 3% goat serum, 0.1% BSA, 0.1% Tween 20 for 2 hours, embryos were incubated with the primary antibody overnight at 4°C in blocking solution. After several washes in PBS containing 0.1% Tween-20 (PBST) samples were incubated with Donkey anti-rabbit 488 secondary antibodies.
A. E7.0 (Mid streak embryos) B. E7.0 (Late streak embryos)
Image from Burtscher Ingo et.al., Development. 2009 Mar;136(6):1029-38 Fig 1.

ICC/IF image of ab40874 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab40874, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
3
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
