
  • Product nameAnti-GNAI3 antibody
    See all GNAI3 primary antibodies
  • Description
    Rabbit polyclonal to GNAI3
  • Tested applicationsWBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 43-92 (ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRL K) of Human GNAI3 (NP_006487).

  • Positive control
    • Fetal Brain Lysate


Associated products


Our Abpromise guarantee covers the use of ab108172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionGuanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K(+) channels. The active GTP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. May play a role in cell division.
  • Sequence similaritiesBelongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localizationCytoplasm. Cell membrane. Cytoplasm > cytoskeleton > centrosome. Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.
  • Information by UniProt
  • Database links
  • Alternative names
    • 87U6 antibody
    • FLJ26559 antibody
    • G protein alpha inhibiting 3 antibody
    • G(i) alpha 3 antibody
    • G(i) alpha-3 antibody
    • GNAI3 antibody
    • GNAI3_HUMAN antibody
    • Guanine nucleotide binding protein (G protein) alpha inhibiting activity polypeptide 3 antibody
    • Guanine nucleotide binding protein G(k) alpha subunit antibody
    • Guanine nucleotide-binding protein G(k) subunit alpha antibody
    • OTTHUMP00000013368 antibody
    see all

Anti-GNAI3 antibody images

  • Anti-GNAI3 antibody (ab108172) at 1 µg/ml + Fetal Brain Lysate at 10 µg

    Predicted band size : 41 kDa

References for Anti-GNAI3 antibody (ab108172)

ab108172 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108172.
Please use the links above to contact us or submit feedback about this product.