Anti-GRIK5 antibody (ab85441)


  • Product nameAnti-GRIK5 antibodySee all GRIK5 primary antibodies ...
  • Description
    Rabbit polyclonal to GRIK5
  • Tested applicationsIHC-P, WB more details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 468-517 of Human GRIK5 (EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPF M)

  • Positive control
    • Jurkat cell lysate.



Our Abpromise guarantee covers the use of ab85441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 109 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds kainate > quisqualate > domoate > L-glutamate >> AMPA >> NMDA = 1S,3R-ACPD.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK5 subfamily.
  • Cellular localizationCell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Target information above from: UniProt accession Q16478 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • EAA 2 antibody
    • EAA2 antibody
    • Excitatory amino acid receptor 2 antibody
    • GluRgamma2 antibody
    • Glutamate receptor antibody
    • Glutamate receptor KA 2 antibody
    • Glutamate receptor KA-2 antibody
    • Glutamate receptor KA2 antibody
    • Glutamate receptor, ionotropic kainate 5 [Precursor] antibody
    • Glutamate receptor, ionotropic, kainate 5 (gamma 2) antibody
    • Glutamate receptor, ionotropic, kainate 5 antibody
    • GRIK 2 antibody
    • GRIK 5 antibody
    • GRIK2 antibody
    • Grik5 antibody
    • GRIK5_HUMAN antibody
    • iGlu5 antibody
    • ionotropic kainate 5 antibody
    • KA2 antibody
    • MGC118086 antibody
    see all

Anti-GRIK5 antibody images

  • Anti-GRIK5 antibody (ab85441) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 109 kDa
  • Immunohistochemistry of Mouse Retina tissue at an antibody concentration of 25µg/ml using anti-GRIK5 antibody (ab85441)

References for Anti-GRIK5 antibody (ab85441)

ab85441 has not yet been referenced specifically in any publications.

Product Wall

Application Immunocytochemistry
Sample Monkey Cultured Cells (COS-7)
Specification COS-7
Fixative Paraformaldehyde
Permeabilization Yes - 0.5% Triton X
Blocking step BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Dr. Taro Fujikawa

Verified customer

Submitted Mar 30 2012

I am very pleased to hear you would like to accept our offer and test ab85441 in ICC. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for ICC and include this code in the Addit...

Read More

Thank you very much for your interest in ab85441 and ab118954.

To our knowledge, ab85441 and ab118954 have not been tested in ICC. Therefore, I can offer a discount off a future purchase if you buy ab85441 and/or 118954now, test it inICC and...

Read More