Anti-GSTM2 antibody (ab175282)
Key features and details
- Rabbit polyclonal to GSTM2
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GSTM2 antibody
See all GSTM2 primary antibodies -
Description
Rabbit polyclonal to GSTM2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human GSTM2 aa 1-218.
Sequence:MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDIL ENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLG DKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKS SRFLPRPVFTKMAVWGNK
Database link: P28161 -
Positive control
- HeLa whole cell lysate (ab150035).
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175282 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 26 kDa.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
WB
1/500 - 1/2000. Predicted molecular weight: 26 kDa. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. -
Tissue specificity
Muscle. -
Sequence similarities
Belongs to the GST superfamily. Mu family.
Contains 1 GST C-terminal domain.
Contains 1 GST N-terminal domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 2946 Human
- Omim: 138380 Human
- SwissProt: P28161 Human
- Unigene: 279837 Human
-
Alternative names
- Glutathione S alkyltransferase M2 antibody
- Glutathione S aralkyltransferase M2 antibody
- Glutathione S aryltransferase M2 antibody
see all
Images
-
Anti-GSTM2 antibody (ab175282) at 1/500 dilution + HeLa cell lysate
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling GSTM2 with ab175282 at 1/200. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175282. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175282 has been referenced in 1 publication.
- Fafián-Labora JA et al. Small Extracellular Vesicles Have GST Activity and Ameliorate Senescence-Related Tissue Damage. Cell Metab 32:71-86.e5 (2020). PubMed: 32574561