You have changed your country from to
. Please be aware that this will change the currency in the purchasing process.
Related products
- Proteins and Peptides
- Secondary antibodies
Reassurance, Refunds & Replacements
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab49314 for help.
Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.
|
|||||||||
 | |||||||||
|
|||||||||
Hi! Karen, Thanks for the reply in Sep 2011. We tried the optimize the WB according to your suggestion. Unfortunately, it didn't work for this antibody. Do you have any idea or should we try other antibody? Attached is the details of repeated experiment and image. I am looking forward to hearing from you. |
|||||||||
ANSWER: |
Thank you for your reply. I am sorry to hear the results have not improved. The only other thing that might help is incubating the primary antibody at room temperature for 4-6 hours. However, if there is no improvement I can replace with the same product or an alternative. We have two other anti-Gli antibodies: ab49314 www.abcam.com/ab49314 ab94927 www.abcam.com/ab94927 I look forward to your reply. |
||||||||
|
|||||||||
ab49314 did not work in IHC-FoFr |
|||||||||
ANSWER: |
Thank you for contacting us.
I am sorry that this antibody did not perform as stated on the datasheet. I have asked our accounting department to issue a credit note for you, which can be redeemed against the invoice of a future order by passing it on to your purchasing department. To avoid confusion, please ensure your accounts department is aware of how the credit note is being used. If you have questions on how to use the credit note, please contact our accounting department.
Our accounting department can be contacted by email at us.credits@abcam.com or by telephone using the information at the Contact Us link in the top right corner of our website. Please refer to the credit note ID in any correspondence with our accounting department.
The credit note ID is for your reference only and does not automatically guarantee the credit.
I hope this experience will not prevent you from purchasing other products from us in the future. Our Scientific Support team is always at your service, should you require further expert advice. |
||||||||
|
|||||||||
Will this recognize the mouse protein? |
|||||||||
ANSWER: |
The immunogen for this antibody is a 14 amino acid peptide derived from the following 50 amino acid sequence (the exact sequence is not given as it is proprietary information): TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP The exact immunogen sequence is 92%, 13 in 14 amino acids, homologous to mouse protein. The antibody may recognize the mouse protein but this has not been tested and we do not guarantee this reactivity. Please contact us if you have further questions. |
||||||||
|
|||||||||
| |||||||||
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
