You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Glutamate Receptor 1 (AMPA subtype) protein (ab112297)

Submit an Abreview Submit a Question

Overview

  • Product nameGlutamate Receptor 1 (AMPA subtype) proteinSee all Glutamate Receptor 1 (AMPA subtype) proteins and peptides ...
  • Protein descriptionRecombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 (AMPA subtype) with a proprietary tag; Predicted MWt 36.63 (UniProt P42261).
  • Uniprot accessionP42261
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • Biological activityuseful for Antibody Production and Protein Array
  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced
  • Concentration information loading...
  • SequenceVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR VDWKRPKYTSALTYDGVKVM
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab112297 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        GLUR 1 GLUR AAMPA 1
        AMPA selective glutamate receptor 1AMPA-selective glutamate receptor 1GluA1GLUH1GluR K1GluR-1GluR-AGluR-K1GLUR1GLURAGluRK1Glutamate receptor 1Glutamate receptor ionotropicGlutamate receptor ionotropic AMPA 1Glutamate receptor, ionotropic, AMPA 1Gria1GRIA1_HUMANHBGR1MGC133252OTTHUMP00000160643OTTHUMP00000165781OTTHUMP00000224241OTTHUMP00000224242OTTHUMP00000224243
      see all
  • FunctionIonotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Tissue specificityWidely expressed in brain.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.
  • Post-translational
    modifications    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localizationCell membrane. Endoplasmic reticulum membrane. Cell junction > synapse > postsynaptic cell membrane. Interaction with CACNG2 promotes cell surface expression.

    • Target information above from: UniProt accession P42261 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Glutamate Receptor 1 (AMPA subtype) protein images

    • SDS-PAGE - Glutamate Receptor 1 (AMPA subtype) protein (ab112297)
      SDS-PAGE - Glutamate Receptor 1 (AMPA subtype) protein (ab112297)
      ab112297 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

    References for Glutamate Receptor 1 (AMPA subtype) protein (ab112297)

    ab112297 has not yet been referenced specifically in any publications.

    Publishing research using ab112297 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab112297 Submit a Question for ab112297

    There are currently no Abreviews or Questions for ab112297.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"