You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Growth hormone receptor protein (Fc Chimera) (ab83991)

Overview

  • Product nameGrowth hormone receptor protein (Fc Chimera)See all Growth hormone receptor proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to extracellular amino acids 19-254 of Human Growth hormone receptor (Swiss-Prot P10912) fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified human 293 cells.
  • Expression hostBaculovirus
  • Properties

  • Purity> 95 % by SDS-PAGE
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin
  • Concentration information loading...
  • Sequence notesTheoretical sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC RSPERETFSC HWTDEVHHGTKNLGPIQLFYTRRNTQEW TQEWKECPDYVSAGENSCYF NSSFTSIWIPYCIKLTSN GGTVDEKCFSVDEIVQPDPPIALNWTLLNV SLTGIHAD IQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPI LTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLY VTLPQMRIPK VDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab83991 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    ab83991 migrates as a broad band between 65 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified protein that has a predicted molecular mass of 54.3 kDa. ab83991 consists of 15-35% carbohydrate by weight.

    ab83991 separates into a number of isoforms with a pI between 5.0 and 7.7 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified protein that has a predicted pI of 6.90.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        GH receptorGH-binding proteinGHBP
        GHRGHR_HUMANGrowth hormone binding proteinGrowth hormone receptorGrowth hormone receptor precursorGrowth hormone-binding proteinSerum binding proteinSerum-binding proteinSomatotropin receptor
      see all
  • FunctionReceptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway.
    The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
    Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling.
  • Tissue specificityExpressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is highly expressed in placental villi. Isoform 2 is expressed in lung, stomach and muscle. Low levels in liver.
  • Involvement in diseaseDefects in GHR are a cause of Laron syndrome (LARS) [MIM:262500]. A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone.
    Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).
    The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization.
  • Post-translational
    modifications
    The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17.
    On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2.
    On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization.
  • Cellular localizationSecreted; Cell membrane. On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway and Cell membrane. Remains fixed to the cell membrane and is not internalized.
  • Target information above from: UniProt accession P10912 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Growth hormone receptor protein (Fc Chimera) images

    • Lane 1 – MW markers; Lane 2 – ab83991; Lane 3 – ab83991 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83991 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane; Deep Purple™ stained.

      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
    • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.

      Triangle indicates theoretical pI and MW of the protein.

    References for Growth hormone receptor protein (Fc Chimera) (ab83991)

    ab83991 has not yet been referenced specifically in any publications.

    Product Wall

    Displaying 1 - 1 of 1 results for Abreviews and Q&A

    Thank you for contacting Abcam.
    I have included a number of papers and PubMed ID numbers which will direct you to further papers. These contain the data from which we have gathered the information on our website.
    I hope this information is helpful...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"