You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

HAUSP / USP7 protein (Tagged-His Tag) (ab91746)

Submit an Abreview Submit a Question

Overview

  • Product nameHAUSP / USP7 protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa. UniProt ID = Q93009.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 146 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLS PATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREV MK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWL GLDHFNKAPKRSRYTYLEKAIKI HN
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91746 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Deubiquitinating enzyme 7Herpes virus associated ubiquitin specific proteaseHerpesvirus-associated ubiquitin-specific protease
        TEF 1tef-1TEF1Ubiquitin carboxyl terminal hydrolase 7Ubiquitin carboxyl-terminal hydrolase 7Ubiquitin specific peptidase 7Ubiquitin specific peptidase 7 (herpes virus associated)Ubiquitin specific peptidase 7 herpes virus associatedUbiquitin specific processing protease 7Ubiquitin specific protease 7Ubiquitin specific protease 7 herpes virus associatedUbiquitin thioesterase 7Ubiquitin thiolesterase 7Ubiquitin-specific-processing protease 7UBP 7UBP-7UBP7UBP7_HUMANUSP 7usp-7USP7VMW110-ASSOCIATED PROTEIN, 135-KD
      see all
  • FunctionHydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1. Exhibits a preference towards 'Lys-48'-linked Ubiquitin chains.
  • Tissue specificityWidely expressed. Overexpressed in prostate cancer.
  • Sequence similaritiesBelongs to the peptidase C19 family.
    Contains 1 MATH domain.
  • DomainThe C-terminus plays a role in its oligomerization.
  • Post-translational
    modifications    Isoform 1: Phosphorylated. Isoform 1 is phosphorylated at positions Ser-18 and Ser-963. Isoform 2: Not phosphorylated.
    Isoform 1: Polyneddylated. Isoform 2: Not Polyneddylated.
    Isoform 1 and isoform 2: Not sumoylated.
    Isoform 1 and isoform 2: Polyubiquitinated by herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110; leading to its subsequent proteasomal degradation. Isoform 1: Ubiquitinated at Lys-869.
  • Cellular localizationNucleus. Cytoplasm. Nucleus > PML body. Present in a minority of ND10 nuclear bodies. Association with ICP0/VMW110 at early times of infection leads to an increased proportion of USP7-containing ND10. Colocalizes with ATXN1 in the nucleus. Colocalized with DAXX in speckled structures. Colocalized with PML and PTEN in promyelocytic leukemia protein (PML) nuclear bodies.

    • Target information above from: UniProt accession Q93009 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    HAUSP / USP7 protein (Tagged-His Tag) images

    • SDS-PAGE - HAUSP / USP7 protein (Tagged-His Tag) (ab91746)
      SDS-PAGE - HAUSP / USP7 protein (Tagged-His Tag) (ab91746)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for HAUSP / USP7 protein (Tagged-His Tag) (ab91746)

    ab91746 has not yet been referenced specifically in any publications.

    Publishing research using ab91746 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91746 Submit a Question for ab91746

    There are currently no Abreviews or Questions for ab91746.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"