Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Anti-HDAC9 antibody - ChIP Grade
See all HDAC9 products (7) ...
Rabbit polyclonal to HDAC9 - ChIP Grade
This antibody recognises Histone deacetylase 9, isoform CRA b/isoform 3, also known as HDRP.
WB, IHC-P, ChIP, ELISAmore details
Reacts with
Mouse, Human
Predicted to work with
Dog
A region within synthetic peptide: QVGAVKVKEE PVDSDEDAQI QEMESGEQAA FMQQVIGKDL APGFVIKVII, corresponding to C terminal amino acids 541-590 of Human HDAC9
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDL APGFVIKVII
A172 cell lysate or human kidney tissue.
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 2% Sucrose, PBS
Concentration information loading...
Protein A purified
Polyclonal
IgG
Epigenetics and Nuclear Signaling >> ChIP'ing antibodies >> ChIP'ing antibodies
Cardiovascular >> Heart >> Hypertrophy >> Other
Epigenetics and Nuclear Signaling >> Chromatin Modifying Enzymes >> Acetylation >> HDACs >> Class II / Hda1 Class
Epigenetics and Nuclear Signaling >> Chromatin Modifying Enzymes >> Acetylation
Our Abpromise guarantee covers the use of ab59718 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: Use a concentration of 1.25 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 66 kDa).Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P: Use a concentration of 4 - 8 µg/ml.
ChIP: Use at an assay dependent dilution. PubMed: 20596014
ELISA: Use at an assay dependent dilution.
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Represses MEF2-dependent transcription.
Isoform 3 lacks active site residues and therefore is catalytically inactive. Represses MEF2-dependent transcription by recruiting HDAC1 and/or HDAC3. Seems to inhibit skeletal myogenesis and to be involved in heart development. Protects neurons from apoptosis, both by inhibiting JUN phosphorylation by MAPK10 and by repressing JUN transcription via HDAC1 recruitment to JUN promoter.
Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level).
Note=A chromosomal aberration involving HDAC9 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with TGFB2 resulting in lack of HDAC9 protein.
Belongs to the histone deacetylase family. HD type 2 subfamily.
Phosphorylated on Ser-220 and Ser-450; which promotes 14-3-3-binding, impairs interaction with MEF2, and antagonizes antimyogenic activity. Phosphorylated on Ser-240; which impairs nuclear accumulation (By similarity). Isoform 7 is phosphorylated on Tyr-1010. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.
Sumoylated.
Nucleus.
Target information above from: UniProt accessionQ9UKV0
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Western blot - HDAC9 antibody (ab59718)

Anti-HDAC9 antibody - ChIP Grade (ab59718) at 1.25 µg/ml + A172 cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG used at 1/50000
Predicted band size : 66 kDa
Observed band size : 50 kDa (why is the actual band size different from the predicted?)
Immunohistochemistry (Paraffin-embedded sections) - HDAC9 antibody (ab59718)

Ab59718 (4ug/ml) staining human HDAC9 in human kidney tissue by immunohistochemistry using paraffin embedded tissue.
Epithelial cells of the renal tubule were positively labelled (indicated with arrows).
This product has been referenced in:
See all 2 publications for this product
Publishing research using ab59718? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
