Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Signal Transduction >> Protein Trafficking >> Organelle Proteins
Anti-HPS4 antibody
Mouse polyclonal to HPS4
Reacts with
Human
Fusion protein: GHFAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDTAISS LRPPSA, corresponding to amino acids 385/430 of Human HPS4
GHFAFLHVPV PDGRAPYCKA SLSASSSLEP TPPEDTAISS LRPPSA
Liquid
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Constituents: 50% Glycerol
Whole antiserum
This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al.PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Polyclonal
IgG
Signal Transduction >> Protein Trafficking >> Organelle Proteins
Western blot - HPS4 antibody (ab22147)
(enlarge)
Our Abpromise guarantee covers the use of ab22147 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: 1/1000. Predicted molecular weight: 77 kDa.
Not tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
Hermansky-Pudlak syndrome is a disorder of organelle biogenesis in which oculocutaneous albinism, bleeding, and pulmonary fibrosis result from defects of melanosomes, platelet dense granules, and lysosomes. Mutations in HPS4 gene as well as several others can cause this syndrome. HPS4 appears to be important in organelle biogenesis and is similar to the mouse 'light ear' protein. Five transcript variants encoding different isoforms have been found for this gene. In addition, transcript variants utilizing alternative polyadenylation signals exist.
lysosome, melanosome, membrane fraction and platelet dense granule
Western blot - HPS4 antibody (ab22147)

All lanes : Anti-HPS4 antibody (ab22147) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 77 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
ab22147 has not yet been referenced specifically in any publications.
Publishing research using ab22147? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

All lanes : Anti-HPS4 antibody (ab22147) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 77 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
