Overview

  • Product name
    Hainantoxin-III
  • Description
    Potent, selective TTX-sensitive voltage-gated Na+ channel blocker
  • Biological description
    Potent, selective TTX-sensitive voltage-gated Na+ channel blocker (IC50 = 1.1 nM). Hainantoxin-IV (ab146038) analog. Shows neurotoxic effects in vivo.
  • Purity
    > 98%

Properties

  • Molecular weight
    3608.12
  • Chemical structure
    Chemical Structure
  • Molecular formula
    C154H228N44O45S6
  • Sequence
    GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL (Modifications: C-terminal amide; Disulfide bonds: 2-17, 9-22, 16-29)
  • Storage instructions
    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview
    Soluble in aqueous buffer
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:
  • Liu Z  et al. Sequence-specific 1H-NMR assignment and determination of the secondary structure of hainantoxin-III from the spider Ornithoctonus hainana. Protein Pept Lett 20:761-6 (2013). Read more (PubMed: 22973848) »
  • Liu Z  et al. Structure and function of hainantoxin-III, a selective antagonist of neuronal tetrodotoxin-sensitive voltage-gated sodium channels isolated from the Chinese bird spider Ornithoctonus hainana. J Biol Chem 288:20392-403 (2013). Read more (PubMed: 23703613) »
  • Xiao Y & Liang S Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by two spider toxins: hainantoxin-III and hainantoxin-IV. Eur J Pharmacol 477:1-7 (2003). Read more (PubMed: 14512091) »

See 0 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab146037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE, NOT FOR USE IN HUMANS"

Sign up