Anti-Haptoglobin antibody (ab52652)

Overview

• Product nameAnti-Haptoglobin antibodySee all Haptoglobin primary antibodies ...
• Description
  Mouse polyclonal to Haptoglobin
• Tested applicationsSandwich ELISA, WB more details
• Species reactivity
  Reacts with: Human
  
• Immunogen

  Recombinant fusion protein: ICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVA DQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMS KYQEDTCYGDAGSAFAVHDL corresponding to amino acids 265-364 of Human Haptoglobin

  Run BLAST with Run BLAST with

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 50% Glycerol, Whole serum
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed 12910245; Barry and Johnston PubMed: 9234514). The animal's cells produce the protein, which stimulates the animal's immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Cardiovascular
  • Blood
  • Serum Proteins

  • Cardiovascular
  • Blood
  • Blood Cell Antigens
  • RBC Antigens

Applications

Target

• FunctionAs a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
  Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
• Tissue specificityExpressed by the liver and secreted in plasma.
• Involvement in diseaseAnhaptoglobinemia (AHP) [MIM:614081]: A condition characterized by the absence of the serum glycoprotein haptoglobin. Serum levels of haptoglobin vary among normal persons: levels are low in the neonatal period and in the elderly, differ by population, and can be influenced by environmental factors, such as infection. Secondary hypohaptoglobinemia can occur as a consequence of hemolysis, during which haptoglobin binds to free hemoglobin. Congenital haptoglobin deficiency is a risk factor for anaphylactic non-hemolytic transfusion reactions. Note=The disease is caused by mutations affecting the gene represented in this entry.
• Sequence similaritiesBelongs to the peptidase S1 family.
  Contains 1 peptidase S1 domain.
  Contains 2 Sushi (CCP/SCR) domains.
• Cellular localizationSecreted.

Target information above from: UniProt accession P00738 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 3240 Human
  • Omim: 140100 Human
  • SwissProt: P00738 Human
  • Unigene: 513711 Human
  • Unigene: 702099 Human

• Alternative names
  Binding peptide antibodyBp antibodyHaptoglobin alpha chain antibody

  Haptoglobin alpha(1S) beta antibodyHaptoglobin alpha(2FS) beta antibodyHaptoglobin beta chain antibodyHaptoglobin, alpha polypeptide antibodyHaptoglobin, beta polypeptide antibodyHP antibodyHp2 alpha antibodyHP2 ALPHA2 antibodyHP2ALPHA2 antibodyHPA1S antibodyHPT antibodyHPT_HUMAN antibodyMGC111141 antibodyZonulin antibody

  see all

Anti-Haptoglobin antibody images

• 

  Sandwich ELISA - Haptoglobin antibody (ab52652)
  Standard Curve for Haptoglobin (Analyte: Haptoglobin protein (ab77872)); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse polyclonal to Haptoglobin (ab52652) at 5µg/ml and Detector Antibody Rabbit polyclonal to Haptoglobin (ab85846) at 0.5µg/ml.
• 

  Western blot - Haptoglobin antibody (ab52652)
  All lanes : Anti-Haptoglobin antibody (ab52652) at 1/1000 dilution
  
  Lane 1 : a total protein extract from E coli with 50ng to 100 ng of a tagged fusion protein of an irrelevant antigen
  Lane 2 : a total protein extract from E coli with 50ng to 500ng of the antigen (tagged fusion protein)
  
  Lysates/proteins at 20 µg per lane.
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated, at 1/5000 dilution
  
  Predicted band size : 45 kDa
  

Protocols

Protocol Booklet