Overview

  • Product nameAnti-Hsp70 antibody [C92F3A-5]See all Hsp70 primary antibodies ...
  • Description
    Mouse monoclonal [C92F3A-5] to Hsp70
  • SpecificityDetects a 70kDa protein corresponding to the molecular mass of Hsp70 of SDS PAGE immunoblots. There is no cross-reactivity to Hsc70 (Hsp73).
  • Tested applicationsElectron Microscopy, WB, IP, ELISA, ICC/IF, Flow Cyt, IHC-Fr, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow, Dog, Pig, Caenorhabditis elegans, Macaque Monkey, Bos mutus grunniens , Saguinus oedipus , Onchocerca volvulus, Oncorhynchus tshawytscha
  • Immunogen

    Recombinant fragment corresponding to Human Hsp70 aa 436-503.
    Sequence:

    YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITI


    Database link: P08107

  • EpitopeThe mapped epitope is in the region of amino acid residues 436-503.
  • Positive control
    • HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G and Rat Braiin tumour lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab47455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Electron Microscopy Use at an assay dependent dilution.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 70 kDa.
IP Use at an assay dependent dilution.
ELISA Use at an assay dependent dilution.
ICC/IF Use at an assay dependent dilution.
Flow Cyt Use 1µg for 106 cells.
IHC-Fr Use at an assay dependent dilution.
IHC-P Use at an assay dependent dilution.

Target

Anti-Hsp70 antibody [C92F3A-5] images

  • All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1 µg/ml

    Lane 1 : Cell lysate prepared from human A431 cell line
    Lane 2 : Cell lysate prepared from human A549 cell line
    Lane 3 : Cell lysate prepared from human HCT116 cells line
    Lane 4 : Cell lysate prepared from human Hela cell line
    Lane 5 : Cell lysate prepared from human HEK293 cell line
    Lane 6 : Cell lysate prepared from human HepG2 cell line
    Lane 7 : Cell lysate prepared from human HL-60 cell line
    Lane 8 : Cell lysate prepared from human HUVEC cell line
    Lane 9 : Cell lysate prepared from human Jurkat cell line
    Lane 10 : Cell lysate prepared from human MCF7 cell line
    Lane 11 : Cell lysate prepared from human PC3 cell line
    Lane 12 : Cell lysate prepared from human T98G cell line
    Lane 13 : Rat brain tissue lysates


    Predicted band size : 70 kDa

    All are cancer cell lines.



  • Predicted band size : 70 kDa
    Additional bands at : 70 kDa. We are unsure as to the identity of these extra bands.

    Western blot of Hela cell heat shock lysate, using HRP conjugated goat anti-mouse secondary antibody for detection. (1µg/mL ab47455 was used to detect in 10µg of heat shocked HeLa cell lysate)

  • ab47455 staining Hsp70 in mouse colon cancer tissue section by Immunohistochemistry (Bouin's fixed paraffin embedded tissue sections). The primary antibody was diluted at 1/100,000. A Flourophore conjugated goat anti mouse was used as secondary.  An antibody amplifier™ system was used for staining.

  • Overlay histogram showing HeLa cells stained with ab47455 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab47455, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1:500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

References for Anti-Hsp70 antibody [C92F3A-5] (ab47455)

This product has been referenced in:
  • Zhang Y  et al. Combined pharmacological induction of Hsp70 suppresses prion protein neurotoxicity in Drosophila. PLoS One 9:e88522 (2014). WB ; Fruit fly (Drosophila melanogaster) . Read more (PubMed: 24523910) »
  • Nuss JE  et al. Multi-Faceted Proteomic Characterization of Host Protein Complement of Rift Valley Fever Virus Virions and Identification of Specific Heat Shock Proteins, Including HSP90, as Important Viral Host Factors. PLoS One 9:e93483 (2014). WB . Read more (PubMed: 24809507) »

See all 13 Publications for this product

Product Wall

In normal cells there is still some low expression of HSP70, which is upregulated by heat or injury. I hope this information is helpfu.

Thank you for contacting us.

Yes, this product has been tested sucessfully in rabbit for Western Blotting. Our results show a clean band.

The antibody should specifically detect HSP70 and not HSP73.

Regarding local injury, I ...

Read More

Vielen Dank für Ihre Antwort.

Die Frau Hoffmann ist außer Haus und ich hoffe es ist Ihnen Recht, dass ich mich um Ihren Fall kümmere.

Unser AbTrial ist nur ein Angebot, welches Sie nicht in Anspruch nehmen müssen....

Read More

Vielen Dank für Ihre Email.

Leider bieten wir generell keine Probegrößen zu Testzwecken an. Es ist logistisch bei über 95000 Produkten nicht möglich kleinere Größen anzubieten.

Unserem Wissen na...

Read More

Thank you very much for your call yesterday and for your patience while I've been in touch with the lab about ab47455.

The antibody was used at a 1:100,000 dilution using a novel antibody amplification system, so these results are not typical...

Read More

Thank you for getting back to me.

I agree that it does seem more sensible to try a different antibody as the vial you initially received was showing activity with the human protein. The two alternatives you have suggested, ab2787 or ab5439, h...

Read More

Thank you for contacting us.



I have asked our accounting department to issue a credit note for you, which can be redeemed against the invoice of a future order by passing it on to your purchasing department. To avoid confusion, pl...

Read More

Thank you for your reply.

Your credit note IDsare *******.

I am sorry that this antibody did not perform as stated on the datasheet. If payment has already been made on the original order and you wish to receive a refund, please a...

Read More

I am very pleased to hear you would like to accept our offer and test ab47544 in Bluegill tissues. This code will give you: 1 free PRIMARY ANTIBODY OR VALUE OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for Bl...

Read More

Thank you for contacting Abcam.

I am sorry about the issues you have been having with a few of our antibodies. These antibodies are covered under our Abpromise for six months and are guaranteed to work in western blot on rat samples .
Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"