Overview

  • Product nameAnti-Hsp70 antibodySee all Hsp70 primary antibodies ...
  • Description
    Rabbit polyclonal to Hsp70
  • SpecificityDetects a 70kDa protein corresponding to the molecular mass of inducible hsp70. May cross-react with Hsc70 at lower dilutions.
  • Tested applicationsIHC-Fr, ICC/IF, WB, IP, ICC, IHC-P, ELISA more details
  • Species reactivity
    Reacts with: Human, Orangutan
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Macaque Monkey, African Green Monkey, Chinese Hamster, Bos mutus grunniens , Saguinus oedipus
  • Immunogen

    Full length protein corresponding to Human Hsp70 aa 1-641.
    Sequence: MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL IGDAAKNQVA LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDG DKPKVQVSYKGETKAFYPEEIS SMVLTKMKEIAEAYLGYPVTNAVITV PAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA IAYGLDRTGKGERN VLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH FV EEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGID FYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGS TRIPKVQKLLQDFFNGRDLN KSINPDEAVAYGAAVQAAILMGDKSENV QDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQP GVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANG ILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRE RVSAKN ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLD ANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGG SGSGPTIEEVD
    Database link: P08107

  • Positive control
    • HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G and Rat Braiin tumour lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab79852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
IHC-Fr Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
IF Use at an assay dependent concentration.
WB 1/10000 - 1/25000. Detects a band of approximately 70 kDa.
IP 1/100.
ICC Use at an assay dependent concentration.
IHC-P 1/50.
ELISA Use at an assay dependent concentration.

Target

Anti-Hsp70 antibody images

  • ab79852 staining Hsp70 in Mouse backskin tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).

  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Cell lysates prepared from mouse Pam212 cells
    Lane 2 : Molecular weight marker
  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Molecular weight marker
    Lane 2 : Cell lysates prepared from human A431 cells
    Lane 3 : Cell lysates prepared from human A549 cells
    Lane 4 : Cell lysates prepared from human HCT116 cells
    Lane 5 : Cell lysates prepared from Hela cells
    Lane 6 : Cell lysates prepared from HEK293 cells
    Lane 7 : Cell lysates prepared from HepG2 cells
    Lane 8 : Cell lysates prepared from HL-60 cells
    Lane 9 : Cell lysates prepared from HUVEC cells
    Lane 10 : Cell lysates prepared from Jurkat cells
    Lane 11 : Cell lysates prepared from MCF7 cells
    Lane 12 : Cell lysates prepared from PC3 cells
    Lane 13 : Cell lysates prepared from T98G cells
    Lane 14 : Tissue lysates prepared from Rat brain

References for Anti-Hsp70 antibody (ab79852)

This product has been referenced in:
  • Ozdemir AY  et al. PINCH in the cellular stress response to tau-hyperphosphorylation. PLoS One 8:e58232 (2013). WB ; Human . Read more (PubMed: 23554879) »
  • Jakobsson ME  et al. Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation. J Biol Chem 288:27752-63 (2013). WB . Read more (PubMed: 23921388) »

See all 4 Publications for this product

Product Wall

Application Immunocytochemistry/ Immunofluorescence
Blocking step BSA as blocking agent for 20 minute(s) · Concentration: 5% · Temperature: RT°C
Sample Human Cell (HUVEC)
Specification HUVEC
Permeabilization Yes - 0.1% v/v Triton X-100 pH 7.4 for 5 min at RT
Fixative Paraformaldehyde
Username

Dr. Dimitra Kalamida

Verified customer

Submitted Nov 21 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"