Overview

  • Product nameAnti-Hsp70 antibody
    See all Hsp70 primary antibodies
  • Description
    Rabbit polyclonal to Hsp70
  • SpecificityDetects a 70kDa protein corresponding to the molecular mass of inducible hsp70. May cross-react with Hsc70 at lower dilutions.
  • Tested applicationsIHC-Fr, ICC/IF, WB, IP, ICC, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human, Orangutan
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Macaque Monkey, African Green Monkey, Chinese Hamster, Bos mutus grunniens , Saguinus oedipus
  • Immunogen

    Full length protein corresponding to Human Hsp70 aa 1-641.
    Sequence:

    MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL IGDAAKNQVA LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDG DKPKVQVSYKGETKAFYPEEIS SMVLTKMKEIAEAYLGYPVTNAVITV PAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA IAYGLDRTGKGERN VLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH FV EEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGID FYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGS TRIPKVQKLLQDFFNGRDLN KSINPDEAVAYGAAVQAAILMGDKSENV QDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQP GVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANG ILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRE RVSAKN ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLD ANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGG SGSGPTIEEVD


    Database link: P08107

  • Positive control
    • HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G and Rat Braiin tumour lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab79852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
IF Use at an assay dependent concentration.
WB 1/10000 - 1/25000. Detects a band of approximately 70 kDa.
IP 1/100.
ICC Use at an assay dependent concentration.
IHC-P 1/50.
ELISA Use at an assay dependent concentration.

Target

  • FunctionIn cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell.
  • Tissue specificityHSPA1B is testis-specific.
  • Sequence similaritiesBelongs to the heat shock protein 70 family.
  • Cellular localizationCytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links
  • Alternative names
    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1A antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP70I antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Anti-Hsp70 antibody images

  • ab79852 staining Hsp70 in Mouse backskin tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).

  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Cell lysates prepared from mouse Pam212 cells
    Lane 2 : Molecular weight marker
  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Molecular weight marker
    Lane 2 : Cell lysates prepared from human A431 cells
    Lane 3 : Cell lysates prepared from human A549 cells
    Lane 4 : Cell lysates prepared from human HCT116 cells
    Lane 5 : Cell lysates prepared from Hela cells
    Lane 6 : Cell lysates prepared from HEK293 cells
    Lane 7 : Cell lysates prepared from HepG2 cells
    Lane 8 : Cell lysates prepared from HL-60 cells
    Lane 9 : Cell lysates prepared from HUVEC cells
    Lane 10 : Cell lysates prepared from Jurkat cells
    Lane 11 : Cell lysates prepared from MCF7 cells
    Lane 12 : Cell lysates prepared from PC3 cells
    Lane 13 : Cell lysates prepared from T98G cells
    Lane 14 : Tissue lysates prepared from Rat brain

References for Anti-Hsp70 antibody (ab79852)

This product has been referenced in:
  • Ozdemir AY  et al. PINCH in the cellular stress response to tau-hyperphosphorylation. PLoS One 8:e58232 (2013). WB ; Human . Read more (PubMed: 23554879) »
  • Jakobsson ME  et al. Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation. J Biol Chem 288:27752-63 (2013). WB . Read more (PubMed: 23921388) »

See all 4 Publications for this product

Product Wall

Application Immunocytochemistry/ Immunofluorescence
Blocking step BSA as blocking agent for 20 minute(s) · Concentration: 5% · Temperature: RT°C
Sample Human Cell (HUVEC)
Specification HUVEC
Permeabilization Yes - 0.1% v/v Triton X-100 pH 7.4 for 5 min at RT
Fixative Paraformaldehyde
Username

Dr. Dimitra Kalamida

Verified customer

Submitted Nov 21 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"