Anti-Hyaluronidase PH20 antibody (ab22199)

Overview

• Product nameAnti-Hyaluronidase PH20 antibodySee all Hyaluronidase PH20 primary antibodies ...
• Description
  Mouse polyclonal to Hyaluronidase PH20
• Tested applicationsWB more details
• Species reactivity
  Reacts with Streptococcus pyogenes. Not yet tested in other species.
• Immunogen

  Fusion protein: ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTE LLDQWNSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSY QGLDHENR, corresponding to amino acids 33/120 of Streptococcus pyogenes Hyaluronidase

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Developmental Biology
  • Reproduction
  • Fertilisation

  • Cancer
  • Invasion/microenvironment
  • ECM
  • Extracellular matrix
  • Other

  • Signal Transduction
  • Cytoskeleton / ECM
  • Basal Lamina

  • Signal Transduction
  • Cytoskeleton / ECM
  • Extracellular Matrix
  • ECM Enzymes
  • Other Enzymes

Applications

Target

• FunctionInvolved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
• Tissue specificityTestis.
• Sequence similaritiesBelongs to the glycosyl hydrolase 56 family.
• Post-translational
  modificationsN-glycosylated.
• Cellular localizationCell membrane.

Target information above from: UniProt accession P38567 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt

• Alternative names
  Extracellular hyaluronate lyase antibodyHYA1 antibodyHYAL PH-20 antibody

  HYAL PH20 antibodyHyal-PH20 antibodyHYAL1 antibodyHYAL3 antibodyHYAL5 antibodyHYALP_HUMAN antibodyHyaluronidase PH-20 antibodyHyaluronoglucosaminidase PH-20 antibodyMGC26532 antibodyPH-20 Hyaluronidase antibodyPH20 antibodyPH20 Hyaluronidase antibodySPAG15 antibodySPAM-1 antibodySpam1 antibodySperm adhesion molecule 1 antibodySperm surface protein PH-20 antibodySperm surface protein PH20 antibodyzona pellucida binding antibody

  see all

Anti-Hyaluronidase PH20 antibody images

• 

  Western blot - Hyaluronidase antibody (ab22199)
  All lanes : Anti-Hyaluronidase PH20 antibody (ab22199) at 1/1000 dilution
  
  Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
  Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution
  
  Predicted band size : 99 kDa