Anti-Hyaluronidase PH20 antibody (ab22199)


  • Product nameAnti-Hyaluronidase PH20 antibodySee all Hyaluronidase PH20 primary antibodies ...
  • Description
    Mouse polyclonal to Hyaluronidase PH20
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with Streptococcus pyogenes. Not yet tested in other species.
  • Immunogen

    Fusion protein: ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTELLDQWNSIIA GNDAYDKTNPDMVTFHNKAEKDAQNIIKSYQGLDHENR, corresponding to amino acids 33/120 of Streptococcus pyogenes Hyaluronidase

  • General notesProduced from outbred CD1 mice

    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.


  • FormLiquid
  • Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas


Our Abpromise guarantee covers the use of ab22199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
  • Application notesWB: 1/1000. Predicted molecular weight: 99 kDa.

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
  • Target

    • FunctionInvolved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
    • Tissue specificityTestis.
    • Sequence similaritiesBelongs to the glycosyl hydrolase 56 family.
    • Post-translational
    • Cellular localizationCell membrane.
    • Target information above from: UniProt accession P38567 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Alternative names
      • Extracellular hyaluronate lyase antibody
      • HYA1 antibody
      • HYAL PH-20 antibody
      • HYAL PH20 antibody
      • Hyal-PH20 antibody
      • HYAL1 antibody
      • HYAL3 antibody
      • HYAL5 antibody
      • HYALP_HUMAN antibody
      • Hyaluronidase PH-20 antibody
      • Hyaluronoglucosaminidase PH-20 antibody
      • MGC26532 antibody
      • PH-20 Hyaluronidase antibody
      • PH20 antibody
      • PH20 Hyaluronidase antibody
      • SPAG15 antibody
      • SPAM-1 antibody
      • Spam1 antibody
      • Sperm adhesion molecule 1 antibody
      • Sperm surface protein PH-20 antibody
      • Sperm surface protein PH20 antibody
      • zona pellucida binding antibody
      see all

    Anti-Hyaluronidase PH20 antibody images

    • All lanes : Anti-Hyaluronidase PH20 antibody (ab22199) at 1/1000 dilution

      Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
      Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

      Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

      Predicted band size : 99 kDa

    References for Anti-Hyaluronidase PH20 antibody (ab22199)

    ab22199 has not yet been referenced specifically in any publications.

    Product Wall

    Thank you for your enquiry. To our knowledge, this antibody has yet to be tested in IHC-P. All tested applications are specified on Abcam product datasheets. If you decide to go ahead and purchase this product, please let us know how you get on by s...

    Read More

    Thank you for your enquiry. Ab22199 is suitable for use in Western blotting but has not yet been tested for application in IHC (or any other applications). If you decide to go ahead and purchase this product, please let us know how you get on by sub...

    Read More