You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Hyaluronidase PH20 protein (ab114725)

Submit an Abreview Q&A (3)

Overview

  • Product nameHyaluronidase PH20 proteinSee all Hyaluronidase PH20 proteins and peptides ...
  • Protein descriptionRecombinant fragment (aa 346-445) of Human Hyaluronidase PH20 (P38567) with N-terminal proprietary tag. Mol Wt 36.63 kDa inclusive of tag.
  • Uniprot accessionP38567
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • E.C. Number3.2.1.35
  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • SequenceRSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQG VCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLED LEQFSEKFYCSCYSTLSCKE
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114725 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration. Recombinant protein

    Protein info

    • Alternative names
        HYA1HYAL PH-20HYAL PH20
        Hyal-PH20HYAL1HYAL3HYAL5HYALP_HUMANHyaluronidase PH-20Hyaluronoglucosaminidase PH-20MGC26532PH-20 HyaluronidasePH20PH20 HyaluronidaseSPAG15SPAM-1Spam1Sperm adhesion molecule 1Sperm surface protein PH-20Sperm surface protein PH20zona pellucida binding
      see all
  • FunctionInvolved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
  • Tissue specificityTestis.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 56 family.
  • Post-translational
    modifications    N-glycosylated.
  • Cellular localizationCell membrane.

    • Target information above from: UniProt accession P38567 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Hyaluronidase PH20 protein images

    • SDS-PAGE - Hyaluronidase PH20 protein (ab114725)
      SDS-PAGE - Hyaluronidase PH20 protein (ab114725)
      12.5% SDS-PAGE Stained with Coomassie Blue

    References for Hyaluronidase PH20 protein (ab114725)

    ab114725 has not yet been referenced specifically in any publications.

    Publishing research using ab114725 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114725 Submit a Question for ab114725

    Displaying 1 - 3 of 3 results for Abreviews and Q&A

    10
    Votes: Highest First

    Product code: 112304
    Inquiry: I will like to know if is possible that you send me hyaluronidase PH-20 to use in a research project in my group

    Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

    We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantee...

    Read More

    concentration de ab114725 lot 1384718 GR98907-1 ?
    0.05 mg/ml comme indiqué sur la fiche technique ou 0.1 mg/ml comme indiqué sur le tube?

    Merci de nous avoir contactés.

    Le laboratoire vient de me confirmer que la concentration de la protéineHyaluronidase PH20, lot GR98907-1 est de 0.1 mg/ml.

    La concentration de cette protéine dépend du lot, la f...

    Read More

    functional activity?

    Thank you for contacting us and sorry for the delay of our reply.

    I just received a reply from the source of the Hyaluronidase PH20 protein ab114725. They confirmed that this protein has not been tested for functional studies.
    All tested appl...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"