Loading...
|
ab111673 |
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Signal Transduction >> Metabolism >> Energy Metabolism
Anti-IDH2 antibody
See all IDH2 products (5) ...
Rabbit polyclonal to IDH2
IHC-P, WB, ICC/IFmore details
Reacts with
Human
Predicted to work with
Mouse, Rat, Chicken, Cow, Pig, Caenorhabditis elegans, Zebrafish
Synthetic peptide, corresponding to a region within internal sequence amino acids 143-192 (GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKAT DFVADRAGTFK) of Human IDH2 (NP_002159)
Human fetal muscle lysate.
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 2% Sucrose, PBS
Concentration information loading...
Immunogen affinity purified
ab84726 is purified by a peptide affinity chromatography method.
Polyclonal
IgG
Our Abpromise guarantee covers the use of ab84726 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
IHC-P: Use a concentration of 5 µg/ml
WB: Use a concentration of 1 µg/mlDetects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).
ICC/IF: Use a concentration of 5 µg/ml
Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
Defects in IDH2 are the cause of D-2-hydroxyglutaric aciduria type 2 (D2HGA2) [MIM:613657]. D2HGA2 is a neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features. Both a mild and a severe phenotype exist. The severe phenotype is homogeneous and is characterized by early infantile-onset epileptic encephalopathy and cardiomyopathy. The mild phenotype has a more variable clinical presentation. Diagnosis is based on the presence of an excess of D-2-hydroxyglutaric acid in the urine.
Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Mitochondrion.
Target information above from: UniProt accessionP48735
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Western blot - IDH2 antibody (ab84726)

Anti-IDH2 antibody (ab84726) at 1 µg/ml + Human fetal muscle lysate at 10 µg
Secondary
anti-Rabbit IgG HRP at 1/50000 dilution
Predicted band size : 47 kDa
Observed band size : 47 kDa
Immunocytochemistry/ Immunofluorescence-IDH2 antibody(ab84726)

ICC/IF image of ab84726 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84726, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h.Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH2 antibody (ab84726)

IHC image of ab84726 staining in Hu Colon formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab84726, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
This product has been referenced in:
See 1 publication for this product
Publishing research using ab84726? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

Anti-IDH2 antibody (ab84726) at 1 µg/ml + Human fetal muscle lysate at 10 µg
Secondary
anti-Rabbit IgG HRP at 1/50000 dilution
Predicted band size : 47 kDa
Observed band size : 47 kDa

ICC/IF image of ab84726 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84726, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h.Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

IHC image of ab84726 staining in Hu Colon formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab84726, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
