You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

IL1RA antagonist protein (Active) (ab83761)

Submit an Abreview Submit a Question

Overview

  • Product nameIL1RA antagonist protein (Active)See all IL1RA proteins and peptides ...
  • Protein descriptionRecombinant full length Human IL1RA antagonist expressed in modified human 293 cells, amino acids 26-177 (Swiss-Prot P18510).
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityActivity: The ED50 of IL1RA is typically 30-100 ng/ml as measured by its ability to inhibit IL1 mediated proliferation using the murine D10S cell line.
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGP NVNLEEKIDV VPIEPHALFLGIHGGKMCLSCVKSGDET RLQLEAVNITDLSENRKQDK RFAFIRSDSGPTTSFESA ACPGWFLCTAMEADQPVSLTNMPDEGVMVT KFYFQEDE
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab83761 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    pI: ab83761 separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL1RA that has a predicted pI of 5.4.

    Molecular Mass: ab83761 migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL1RA that has a predicted molecular mass of 17.1 kDa. ab83761 consists of 5-25% carbohydrate by weight.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        DIRAICIL 1RAICIL-1RA
        ICIL1RAIL-1raIL-1ra3IL-1RNIL1 inhibitorIL1F3IL1RAIL1RA_HUMANIL1RNIL1RN (IL1F3)Interleukin 1 receptor antagonistInterleukin-1 receptor antagonist proteinIntracellular IL 1 receptor antagonist type IIIntracellular interleukin 1 receptor antagonist (icIL 1ra)IRAPMGC10430MVCD4Type II interleukin 1 receptor antagonist
      see all
  • FunctionInhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
  • Tissue specificityThe intracellular form of IL1RN is predominantly expressed in epithelial cells.
  • Involvement in diseaseGenetic variation in IL1RN is associated with susceptibility to microvascular complications of diabetes type 4 (MVCD4) [MIM:612628]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
    Defects in IL1RN are the cause of interleukin 1 receptor antagonist deficiency (DIRA) [MIM:612852]; also known as deficiency of interleukin 1 receptor antagonist. Autoinflammatory diseases manifest inflammation without evidence of infection, high-titer autoantibodies, or autoreactive T-cells. DIRA is a rare, autosomal recessive, genetic autoinflammatory disease that results in sterile multifocal osteomyelitis (bone inflammation in multiple places), periostitis (inflammation of the membrane surrounding the bones), and pustulosis (due to skin inflammation) from birth.
  • Cellular localizationCytoplasm and Secreted.

    • Target information above from: UniProt accession P18510 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL1RA antagonist protein (Active) images

    • Functional Studies - IL1RA antagonist protein (Active) (ab83761)
      Functional Studies - IL1RA antagonist protein (Active) (ab83761)
      Densitometry of protein isoforms visualised by 2-DE.
      The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
      The triangle indicates the theoretical MW and pI of the protein.
    • SDS-PAGE - IL1RA antagonist protein (Active) (ab83761)
      SDS-PAGE - IL1RA antagonist protein (Active) (ab83761)
      1D SDS-PAGE of ab83761 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1: ab83761
      Lane 2: ab83761 treated with PNGase F to remove potential N-linked glycans.
      Lane 3: ab83761 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
      10 µg protein loaded per lane.
      Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. Faint bands in lane 3 and lane 4 are glycosidase enzymes.

    References for IL1RA antagonist protein (Active) (ab83761)

    ab83761 has not yet been referenced specifically in any publications.

    Publishing research using ab83761 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab83761 Submit a Question for ab83761

    There are currently no Abreviews or Questions for ab83761.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"