You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

IL2 Receptor gamma protein (Fc Chimera) (ab84065)

Submit an Abreview Submit a Question

Overview

  • Product nameIL2 Receptor gamma protein (Fc Chimera)See all IL2 Receptor gamma proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 23-259 of Human IL2 Receptor gamma fused to the Fc region of human IgG1 (aa 93-330) expressed in modified human 293 cells (Swiss-Prot P31785).
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLS VSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHY WYKNSDNDKVQKCSHYLFSEEITSGCQLQ KKEIHLYQT FVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLS ESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYR HKFSLPSVD GQKRYTFRVRSRFNPLCGSAQHWSEWSHP IHWGSNTSKENPFLFAWIP KVDKKVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab84065 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE SDS-PAGE: Use at an assay dependent dilution. ab84065 migrates as a band between 75 and 105 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified protein that has a predicted MW of 55.1 kDa. ab84065 consists of 25-50% carbohydrate by weight.pI: ab84065 separates into a number of isoforms with a pI between 4.9 and 7.2 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified protein that has a predicted pI of 6.68.

    Protein info

    • Alternative names
        CD132common cytokine receptor gamma chainCytokine receptor common subunit gamma
        Gamma Cgamma(c)gammaCIL-2 receptor subunit gammaIL-2R gamma chainIL-2R subunit gammaIL-2RGIL2RGIL2RG_HUMANIMD4interleukin 2 receptor, gammaInterleukin-2 receptor subunit gammaP64SCIDXSCIDX1
      see all
  • FunctionCommon subunit for the receptors for a variety of interleukins.
  • Involvement in diseaseDefects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID) [MIM:300400]; also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) [MIM:312863]. XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.

    • Target information above from: UniProt accession P31785 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL2 Receptor gamma protein (Fc Chimera) images

    • SDS-PAGE - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      SDS-PAGE - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      1D SDS-PAGE of ab84065 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1: ab84065
      Lane 2: ab84065 treated with PNGase F to remove potential N-linked glycans
      Lane 3: ab84065 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
      10 µg protein loaded per lane; Deep Purple™ stained.

      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent drop in MW after treatment with glycosidase cocktail indicates presence of O-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes.
    • SDS-PAGE - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      SDS-PAGE - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      A sample of ab84065 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel.
      40 µg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms. Spots within the spot train were cut from the gel and identified as IL2 Receptor gamma (Fc Chimera) by protein mass fingerprinting.
    • Functional Studies - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      Functional Studies - IL2 Receptor gamma protein (Fc Chimera) (ab84065)
      Densitometry of protein isoforms visualised by 2-DE.
      The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
      The triangle indicates the theoretical MW and pI of the protein.

    References for IL2 Receptor gamma protein (Fc Chimera) (ab84065)

    ab84065 has not yet been referenced specifically in any publications.

    Publishing research using ab84065 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab84065 Submit a Question for ab84065

    There are currently no Abreviews or Questions for ab84065.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"