You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameIL2 protein (Active)See all IL2 proteins and peptides ...
  • Protein descriptionFull length human Interleukin 2 protein sequence with O-linked oligosaccharides expressed in modified human 293 cells, amino acids 21-153. Swiss ID = P60568.
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityActivity: The ED50 of ab83684 is typically 0.15- 0.25 ng/ml as measured in a cell proliferation assay using the IL2 dependent murine CTLL2 T cell line.
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQ CLEEELKPLEEVLNLAQSKNF HLRPRDLISNINVIVLELKGSETTFMCEYADETATIV E FLNRWITFCQSIISTLT
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab83684 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    pI: ab83684 separates into a number of isoforms with a pI between 6.0 and 7.4 in
    2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL2 that has a predicted pI of 7.05.

    Molecular Mass: ab83684 migrates as a band between 15 and 18 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL2 that has a predicted molecular mass of 15.4 kDa.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        AldesleukinIL 2IL-2
        IL2IL2_HUMANInterleukin 2Interleukin-2Involved in regulation of T cell clonal expansionLymphokineOTTHUMP00000164090POIL2T Cell Growth FactorT-cell growth factorTCGF
      see all
  • FunctionProduced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in diseaseNote=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similaritiesBelongs to the IL-2 family.
  • Cellular localizationSecreted.

    • Target information above from: UniProt accession P60568 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL2 protein (Active) images

    • Functional Studies - IL2 protein (Active) (ab83684)
      Functional Studies - IL2 protein (Active) (ab83684)
      Densitometry of protein isoforms visualised by 2-DE. The triangle indicates the theoretical MW and pI of the protein.
    • SDS-PAGE - IL2 protein (Active) (ab83684)
      SDS-PAGE - IL2 protein (Active) (ab83684)
      1D SDS-PAGE of ab83684 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1 ab83684
      Lane 2 ab83684 treated with PNGase F to remove potential N-linked glycans
      Lane 3 ab83684 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with glycosidase cocktail indicates presence of O-linked glycans. Faint bands in lane 3 and lane 4 are glycosidase enzymes.

    References for IL2 protein (Active) (ab83684)

    ab83684 has not yet been referenced specifically in any publications.

    Publishing research using ab83684 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab83684 Submit a Question for ab83684

    There are currently no Abreviews or Questions for ab83684.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"