You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameIL4 protein (Active)See all IL4 proteins and peptides ...
  • Protein descriptionRecombinant full length human IL4 with N-linked and possibly O-linked oligosaccharides, expressed in modified human 293 cells. Aminoacids 25-153, Swiss ID = P05112.
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityActivity: The ED50 of ab83686 is typically 0.02 - 0.2 ng/ml as measured in a cell proliferation assay using the human growth factor-dependent TF1 cell line.
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: HKCDITLQEIIKTLNSLTEQKTLCTELTV TDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCL G ATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQS TLENFLERLKTIMREKYSKCSS
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab83686 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    Functional Studies FuncS: Use at an assay dependent dilution.
    SDS-PAGE SDS-PAGE: Use at an assay dependent dilution. Migrates as a broad band between 15 and 20 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL4 that has a predicted molecular mass of 15.0 kDa.
  • Application notesThis peptide can be used with studies using ab157745.

    • Protein info

    • Alternative names
        B cell growth factor 1B cell IgG differentiation factorB Cell Stimulatory Factor 1
        B-cell stimulatory factor 1BCGF 1BCGF1BinetrakinBSF-1BSF1IGG1 induction factorIL 4IL-4IL4IL4_HUMANIl4e12Interleukin 4Interleukin 4, isoform 1Interleukin-4Lymphocyte stimulatory factor 1MGC79402Pitrakinra
      see all
  • FunctionParticipates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
  • Involvement in diseaseGenetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similaritiesBelongs to the IL-4/IL-13 family.
  • Cellular localizationSecreted.

    • Target information above from: UniProt accession P05112 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL4 protein (Active) images

    • Functional Studies - IL4 protein (Active) (ab83686)
      Functional Studies - IL4 protein (Active) (ab83686)
      Densitometry of protein isoforms visualised by 2-DE. The triangle indicates the theoretical MW and pI of the protein.
    • SDS-PAGE - IL4 protein (Active) (ab83686)
      SDS-PAGE - IL4 protein (Active) (ab83686)
      1D SDS-PAGE of ab83686 before and after treatment with glycosidases to remove oligosaccharides. A drop in the observed MW after treatment indicates the presence of glycosylation.
      Lane 1: ab83686
      Lane 2: ab83686 treated with PNGase F to remove potential N-linked glycans
      Lane 3: ab83686 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane; Deep Purple™ stained.
      Additional bands in lane 2 and lane 3 are glycosidase enzymes.

    References for IL4 protein (Active) (ab83686)

    ab83686 has not yet been referenced specifically in any publications.

    Publishing research using ab83686 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab83686 Submit a Question for ab83686

    Displaying 1 - 1 of 1 results for Abreviews and Q&A

    10
    Votes: Highest First

    Dear All, a customer of ours would like to know the IU of the following cytokines: AB73185 AB73186 AB83686 AB87385 AB87679 AB88382 AB73197 AB73198 AB73200 AB87934 Please note that sometimes the activity is expressed in ED50, and we found the following con...

    Read More

    Thank you for contacting us. The ED50 is an expression of activity at 50% of its maximum response. Specific activity is just another way of conveying the activity of the protein. To calculate a specific activity, divide 1 x 106 by the ED50 in ng/ml. ...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"