You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameIL4R protein (Active)See all IL4R proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to the signal peptide and extracellular amino acids 1-232 of Human IL4R fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells. Swiss Prot P24394.
  • Expression hostHEK 293 cells

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityThe ED50 of IL4R - Fc Chimera is typically 45-60 ng/ml as measured by its ability to neutralize IL-4 mediated proliferation of the human growth factor dependent TF-1 cell line.
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNC STELRLLYQLVFLLSEAHTCIPEN NGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPS EHVKPRAPGNL TVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDP ADFRIYNVTYLEP SLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWH NSYREPFEQHG SSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab83756 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    Under reducing conditions IL4R - Fc Chimera migrates as a broad band between 60 and 75 kDa in SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified IL4R - Fc Chimera that has a predicted monomeric molecular mass of 51 kDa.

    IL4R - Fc Chimera separates into a number of isoforms with a pI between 5.5 and 6.5 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL4R – Fc Chimera that has a predicted pI of 6.5.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        CD124IL 4R alphaIL-4 receptor subunit alpha
        IL-4-binding proteinIL-4R subunit alphaIL-4R-alphaIL-4RAIL4-BPIl4rIL4RAIL4RA_HUMANInterleukin 4 receptorInterleukin 4 receptor alpha chainsIL4Ralpha/protSoluble IL-4 receptor subunit alphaSoluble IL-4R-alphaSoluble interleukin-4 receptor subunit alpha
      see all
  • FunctionReceptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammmation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
    Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
  • Tissue specificityIsoform 1 and isoform 2 are highly expressed in activated T-cells.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe extracellular domain represents the IL4 binding protein (IL4BP).
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications    On IL4 binding, phosphorylated on C-terminal tyrosine residues. Phosphorylation on any one of tyrosine residues, Tyr-575, Tyr-603 or Tyr-631, is required for STAT6-induced gene induction.
    The soluble form (sIL4R/IL4BP) can also be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase.
  • Cellular localizationSecreted and Cell membrane.

    • Target information above from: UniProt accession P24394 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL4R protein (Active) images

    • SDS-PAGE - IL4R protein (Fc Chimera) (ab83756)
      SDS-PAGE - IL4R protein (Fc Chimera) (ab83756)
      Lane 1: MW markers; Lane 2: IL4R - Fc Chimera; Lane 3: IL4R - Fc Chimera treated with PNGase F to remove potential N-linked glycans; Lane 4: IL4R - Fc Chimera treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.

      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
    • Functional Studies - IL4R protein (Fc Chimera) (ab83756)
      Functional Studies - IL4R protein (Fc Chimera) (ab83756)
      Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.

      The triangle indicates theoretical pI and MW of the protein.

    References for IL4R protein (Active) (ab83756)

    ab83756 has not yet been referenced specifically in any publications.

    Publishing research using ab83756 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab83756 Submit a Question for ab83756

    There are currently no Abreviews or Questions for ab83756.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"